Dbfetch

ID   BC043053; SV 1; linear; mRNA; STD; MUS; 2898 BP.
XX
AC   BC043053;
XX
DT   22-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus valosin containing protein, mRNA (cDNA clone MGC:57954
DE   IMAGE:6418662), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2898
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2898
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (09-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e62ef726385d25c5c108c4919d7c0576.
DR   Ensembl-Gn; ENSMUSG00000028452; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028196; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028152; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028104; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028172; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027894; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028613; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027334; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_FVBNJ_G0027976; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028108; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028649; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027060; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027414; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000030164; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065244; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065290; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065186; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065220; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064895; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065689; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065206; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_FVBNJ_T0064901; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065077; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065865; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064742; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064104; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2898
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EW0"
FT                   /clone="MGC:57954 IMAGE:6418662"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2898
FT                   /gene="Vcp"
FT                   /note="synonyms: p97, CDC48, 3110001E05"
FT   CDS             234..2654
FT                   /codon_start=1
FT                   /gene="Vcp"
FT                   /product="valosin containing protein"
FT                   /db_xref="GOA:Q01853"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="MGI:MGI:99919"
FT                   /db_xref="PDB:1E32"
FT                   /db_xref="PDB:1R7R"
FT                   /db_xref="PDB:1S3S"
FT                   /db_xref="PDB:2PJH"
FT                   /db_xref="PDB:3CF0"
FT                   /db_xref="PDB:3CF1"
FT                   /db_xref="PDB:3CF2"
FT                   /db_xref="PDB:3CF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01853"
FT                   /protein_id="AAH43053.1"
FT                   /translation="MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPK
FT                   MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQP
FT                   CPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEF
FT                   KVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVEL
FT                   PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGE
FT                   SESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH
FT                   VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQV
FT                   ANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
FT                   SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFY
FT                   GPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
FT                   DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILR
FT                   PGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA
FT                   CKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIR
FT                   KYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG"
FT   misc_difference 2863..2898
FT                   /gene="Vcp"
FT                   /note="polyA tail: 36 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2898 BP; 762 A; 658 C; 789 G; 689 T; 0 other;
     cgtcgtttga ttagtcgctg cccccctcgc ggattaggag ctagcgtctc ccgcccgccc        60
     gcctgccgcc ccggtgcccc tgggaggaag cgagagggag gctgccagag ggtttgtcac       120
     tgctgttgct cctccgcctc agcgagtcca gccccggcct agtcggtcgc ctgcctttct       180
     catagccgtt accctcaggc cgccacagcc gccgaccggg agaggcgcgc gccatggcct       240
     ctggagccga ttcaaaaggt gatgatttat caacagccat tctcaaacag aagaaccgac       300
     ccaatcggtt aattgttgat gaagccatca atgaagataa cagcgtggtg tccttgtccc       360
     agcccaagat ggatgaactg cagttgttcc gaggtgacac ggtgttgcta aaaggaaaga       420
     aaagacggga agctgtatgc attgttcttt ctgatgacac gtgttctgat gagaagattc       480
     gaatgaatag agttgttcgg aataacctcc gagttcgcct aggagatgtc atcagcatcc       540
     agccatgccc tgatgtaaag tatggcaaac gtatccacgt tctacccatc gatgacacag       600
     tggaaggcat cactggcaat ctctttgagg tataccttaa gccgtacttc ctggaagctt       660
     atcggcccat ccgtaaagga gatatttttc ttgtccgggg tgggatgcgt gctgtggagt       720
     tcaaagttgt agagacagat cccagccctt actgtattgt tgctccagac acagtgatcc       780
     actgtgaggg ggagccaatc aagcgagagg atgaggagga atccttgaat gaagtaggct       840
     atgatgacat cggtggttgc aggaagcagc tagctcagat aaaggagatg gtggagctgc       900
     cactgagaca tcctgcgctc tttaaggcga ttggtgtaaa gcctcctcgg ggaatcttgt       960
     tgtatgggcc tcctgggaca gggaagaccc tgattgctcg agctgtggca aatgaaactg      1020
     gagccttctt ctttctgatc aatggtcctg aaatcatgag caaattggct ggtgagtctg      1080
     agagcaacct tcgtaaagcc tttgaggaag ctgaaaagaa tgctcctgct atcatcttca      1140
     tcgatgagct tgatgccatt gcacccaaaa gagagaaaac tcatggggaa gtggagcgtc      1200
     gcatcgtgtc tcagttgttg accctcatgg atggcctaaa gcagagagca catgtgatag      1260
     ttatggcagc aaccaataga cccaacagca ttgacccagc cctacggcga tttggtcgct      1320
     ttgacagaga ggtagatatt ggaatacctg atgctacagg acgtttggag attcttcaga      1380
     tccataccaa gaacatgaaa ctggcagatg atgtggactt ggaacaggta gccaatgaga      1440
     ctcatggtca tgttggtgct gatttggcag ccctatgttc agaggctgct ctgcaggcca      1500
     tccggaaaaa aatggacctc attgacctag aagatgagac cattgatgct gaggtcatga      1560
     attccctggc agttactatg gatgacttcc ggtgggcttt gagtcaaagc aacccatcag      1620
     cacttcggga aactgtggta gaggtgccac aagtaacctg ggaagatatt ggaggcctgg      1680
     aggatgtcaa acgtgagctt caggagttgg ttcagtatcc tgtggaacat ccagacaaat      1740
     tcctcaaatt tggcatgact ccctccaaag gcgttctttt ctatggacct cctggctgtg      1800
     ggaaaacctt actggctaaa gccattgcta atgaatgcca ggccaacttc atctccatca      1860
     agggtcctga gctgcttacc atgtggtttg gggaatctga ggccaatgtc cgggaaattt      1920
     ttgacaaggc acggcaagct gccccctgtg tactcttctt tgatgagtta gattcaattg      1980
     ccaaggctcg aggtggtaat attggagatg gtggtggagc tgctgaccga gtcatcaatc      2040
     agatcctgac agaaatggat ggcatgtcta caaaaaagaa tgtgtttatc attggagcta      2100
     ccaacaggcc tgacatcatt gatcctgcta tcctaagacc tggccgtcta gatcagctca      2160
     tttatatccc acttcctgat gagaagtccc gtgttgccat cctaaaagcc aatctgcgaa      2220
     agtccccagt tgccaaggat gtggatttgg agttcctggc taagatgact aatggctttt      2280
     ctggagctga tttgacagaa atttgccaac gggcttgtaa actggccatt cgtgaatcta      2340
     ttgagagtga gattaggcga gaacgagaga ggcagacaaa tccatcggct atggaggtag      2400
     aagaggacga tccagtgcct gagatccgca gagatcactt tgaggaagcc atgcgttttg      2460
     cccgacgttc tgtcagcgat aatgacattc ggaagtatga aatgttcgcc cagacactgc      2520
     agcagagtcg aggttttggc agcttcagat tcccttcagg gaaccagggt ggagctggtc      2580
     ccagccaggg cagtggaggt ggcacaggtg gcagtgtgta cacagaagac aatgacgatg      2640
     acctgtatgg ctaagtgatg tgccagcatg cagcgagctg gcctggctgg accttgttcc      2700
     ctgggggagg gggcgcttgc ccaagaggga ccaggggtgt gcccatggcc tgttccattc      2760
     ctcagtctga acagttcagc cccagtcaga ctctggacag gggtttcctg ttgcaaaaaa      2820
     aaaaaattac aaaagcgata aaataaaagt gattttcatt tgaaaaaaaa aaaaaaaaaa      2880
     aaaaaaaaaa aaaaaaaa                                                    2898
//