spacer

EBI Dbfetch

ID   BC042626; SV 1; linear; mRNA; STD; MUS; 1651 BP.
XX
AC   BC042626;
XX
DT   17-JAN-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus chromatin modifying protein 2B, mRNA (cDNA clone
DE   IMAGE:4011023), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1651
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1651
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 55b5152a7d15617569543b44339cd09e.
DR   Ensembl-Gn; ENSMUSG00000004843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004965; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 41 Row: a Column: 5.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1651
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu30"
FT                   /clone="IMAGE:4011023"
FT                   /tissue_type="Mammary tumor metastatized to lung.
FT                   MMTV-LTR/Wnt1 model. Expression driven by an MMTV-LTR
FT                   enhancer."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1651
FT                   /gene="Chmp2b"
FT   CDS             <1..587
FT                   /codon_start=3
FT                   /gene="Chmp2b"
FT                   /product="Chmp2b protein"
FT                   /db_xref="GOA:Q8BJF9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="MGI:MGI:1916192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJF9"
FT                   /protein_id="AAH42626.1"
FT                   /translation="ELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQ
FT                   LVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQ
FT                   TMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAP
FT                   SAARSLPSASTSKATISDEEIERQLKALGVD"
FT   misc_difference 494
FT                   /gene="Chmp2b"
FT                   /note="'T' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 618
FT                   /gene="Chmp2b"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 867
FT                   /gene="Chmp2b"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 878
FT                   /gene="Chmp2b"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 896
FT                   /gene="Chmp2b"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1099
FT                   /gene="Chmp2b"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1116
FT                   /gene="Chmp2b"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1118
FT                   /gene="Chmp2b"
FT                   /note="'A' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1314
FT                   /gene="Chmp2b"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1351
FT                   /gene="Chmp2b"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1475
FT                   /gene="Chmp2b"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1597..1651
FT                   /gene="Chmp2b"
FT                   /note="polyA tail: 55 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1651 BP; 571 A; 294 C; 335 G; 451 T; 0 other;
     gagagctgcg tggcacccag agggccatca tcagggaccg agcagcctta gagaaacagg        60
     agaaacagct ggagttagaa attaagaaga tggccaagat tggtaataag gaagcgtgca       120
     gggttttagc taagcagctt gtccacctac ggaaacagaa gacaagaacg ttcgctgtaa       180
     gctcaaaagt cacctctatg tccacacaaa cgaaagtgat gaattcccag atgaagatgg       240
     ccggtgccat gtctaccact gcaaagacaa tgcaagcagt caacaagaaa atggatccac       300
     agaagacact acaaacaatg cagaatttcc agaaggaaaa catgaaaatg gaaatgactg       360
     aagaaatgat caatgacacc ctggatgaca tctttgatgg ctctgatgat gaagaagaaa       420
     gccaggacat cgtgaatcaa gttcttgatg aaattgggat tgaaatctct ggaaagatgg       480
     ccaaagctcc atctgctgca agaagcttac cgtctgcctc cacttcaaag gctacaattt       540
     ctgatgaaga gattgaacgt caactcaaag ctttaggggt agattagatc aaaagccata       600
     catactgttc tcacttgggt ctaaagtgag tccggtgtag attcctttta caaaacacat       660
     tcattttgca aaaatgaaga ccatgagtga acagttattt cctgacccat ggctactttg       720
     aatcctttgc caaagagtgc caatgatgca aaaaacaatg ggagcagttt ggctcttagg       780
     tagaagcacc ctggtctgag gggtgtgcaa gctgagttct tttgtgcatg gcatagggag       840
     acgacggtgt cactgcttag tgttggcttg ggttctacgt tgttttacac tgaaaccaga       900
     cttcatgttt aatgccatta ggcgtcaacg taaagagact tgtaaaaata ttaaaggtat       960
     atcgttaatt ctgtatctgt tgcttgtcct ttgtagacag ttatgttagg accataggca      1020
     gtgcagctgc caagttattt ttaaaccatc taaaaggaga gtgctattta aacatctgtc      1080
     ttaaactgtc ctgagctttt acttttcttc catttccacc ctttgggaga acattctagt      1140
     tggtaagttt attacctttc aaaatgtgct tggcacctgc cttaaatagc acgaacatat      1200
     tgtgcacatc tttaaattaa tttaactggc aaaaaaacaa ttacatttta aactaaaact      1260
     gagactgaga acagtaccca atctgtcttt taaagcttat aaaagtgaat cggatacaat      1320
     tagcaaaaag aagaaagaag acactgaatt aatgacgttt tacagtaatg aagctatact      1380
     ttggtctttc ttccaagaac tgcgattttt ctctgtatga attataactt agtctgtgtt      1440
     ggaactttga attgtgtaat atacacatta aaccctctaa attgaagcca ttcttctaaa      1500
     ggaaggactg ctactttgac agtacttgat ccagatttct aaagaaaatg tttttgtttt      1560
     gttgtgtttt tggtaaataa actgcaactt tgtcagaaaa aaaaaaaaaa aaaaaaaaaa      1620
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a                                     1651
//


spacer
spacer