spacer

EBI Dbfetch

ID   BC042570; SV 1; linear; mRNA; STD; MUS; 4783 BP.
XX
AC   BC042570;
XX
DT   07-JAN-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus protein phosphatase 1F (PP2C domain containing), mRNA (cDNA
DE   clone MGC:25978 IMAGE:4241448), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4783
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4783
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a91e3abe136c6bd2a621e121bb448713.
DR   Ensembl-Gn; ENSMUSG00000026181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027373; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: g Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31341186.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4783
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:25978 IMAGE:4241448"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4783
FT                   /gene="Ppm1f"
FT                   /note="synonyms: CaMKPase, MGC25978, mKIAA0015"
FT   misc_difference 1..2
FT                   /gene="Ppm1f"
FT                   /note="2 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             71..1429
FT                   /codon_start=1
FT                   /gene="Ppm1f"
FT                   /product="protein phosphatase 1F (PP2C domain containing)"
FT                   /db_xref="GOA:Q8CGA0"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="MGI:MGI:1918464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGA0"
FT                   /protein_id="AAH42570.1"
FT                   /translation="MASGAAQNSSQMACDSEIPGFLDAFLQDFPAPLSLESPLPWKVPG
FT                   TVLSQEEVEAELIELALGFLGSRNAPPSFAVAVTHEAISQLLQTDLSEFKRLPEQEEEE
FT                   EEEEEEKALVTLLDAKGLARSFFNCLWKVCSQWQKQVPLTAQAPQWQWLVSIHAIRNTR
FT                   RKMEDRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASVHVHTNASHQPELRT
FT                   NPAAALKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDSQVILVQQGR
FT                   VVKLMEPHKPERQDEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQKPYVSGEADA
FT                   ASRELTGSEDYLLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMRIAEELVAVARDRGS
FT                   HDNITVMVVFLREPLELLEGGVQGTGDAQADVGSQDLSTGLSELEISNTSQRS"
FT   misc_difference 4770..4783
FT                   /gene="Ppm1f"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4783 BP; 1115 A; 1204 C; 1321 G; 1143 T; 0 other;
     ggcagagtga agacttgact ggagactgtc tcaccccagc ctagctgcaa acccccggaa        60
     tgcactgggc atggcctctg gagccgcaca gaacagcagc cagatggcct gtgacagtga       120
     gatcccaggc ttcctggacg cattcctcca agacttccca gccccactga gcctggagag       180
     ccctttgcca tggaaggtcc cagggacagt cctgagccag gaagaagtgg aggctgagct       240
     gattgagctg gcattgggct tcctgggcag caggaacgct cccccatcgt ttgctgtggc       300
     tgtgacccac gaggcaattt cccagctgct gcagacagac ctttctgaat ttaagaggtt       360
     gcctgaacaa gaggaggagg aggaagagga ggaagaagag aaagccctcg tgaccttact       420
     agatgccaaa ggcctggcac ggagcttctt caactgcctt tggaaagtat gtagccagtg       480
     gcagaagcag gtgccgttga ctgcccaggc ccctcagtgg cagtggctgg tctctatcca       540
     tgccatccgg aacacacgac gcaagatgga ggaccgacac gtgtcccttc ctgctttcaa       600
     ccatctcttc ggcttgtctg actctgtgca ccgtgcctac tttgctgtgt ttgatggtca       660
     tggaggcgtg gatgcagcaa ggtatgcctc tgtccacgtg cataccaatg cttctcacca       720
     gccagagctg cgcacaaacc ctgcagcagc tctcaaagaa gccttccggc tcaccgatga       780
     gatgtttctc cagaaagcca agcgagagcg actgcagagc ggtaccacgg gtgtgtgtgc       840
     actcatcgcg ggagcagccc tgcatgttgc ctggcttgga gactcccagg tcatcctggt       900
     acagcaagga cgggtagtga agctgatgga gccgcacaaa ccggagcgac aggatgagaa       960
     agcacgaatt gaagccctgg gtggctttgt ttctctcatg gactgttgga gagtcaacgg      1020
     gaccctggca gtgtctagag ccattgggga tgtcttccag aagccctatg tgtctgggga      1080
     ggccgatgca gcatccagag agctaacggg ctcagaggac tacctgttgc ttgcttgtga      1140
     tggtttcttc gatgttgtcc cccaccatga agtcacgggt ctcgtccatg gccacttgct      1200
     caggcacaag ggcaatggga tgcgtattgc tgaggagctg gtggctgtgg cccgtgaccg      1260
     gggctcccat gacaacatta cagtcatggt ggtcttcctt agggagcccc tggagctgct      1320
     agagggtgga gtccagggga caggggatgc ccaggcagat gtaggaagcc aggacttgtc      1380
     cactggcctc tcagaacttg agatcagtaa tacctcacag agaagctaag tggtccaggc      1440
     ctccaggccc catccggact ctccctctgc cctcgtgatc ctccccttca aagaccttag      1500
     atccaaaagg tatagtgggc aggggtgcac actctcacag cattccctta gcaccccagc      1560
     ccttcatgtt gcctaccaca gcctgtcctc atggctgcag aactgcagta ggcagctagt      1620
     ggatctcaga aggaaacata ggaaaatggc ctcaccgaag agcagatggc tgaggtgatc      1680
     agggccggac aggtctggga acagaaacca caggcacctg ctggtagcct aaccaaaaac      1740
     acaggtcagg tcttggagga ccctcacaca gatcctggaa tgagatctgc agccaggtgt      1800
     ccagcccagg cttgtggctt ctcattgtac ccaaggctgg gagggtttgg tctgtactaa      1860
     cacacaagct cgcagtcctg cttgactgct ggcttcccaa agaggagaca ttggtcttgc      1920
     tgggaggcac agcaggagag tgacccactg ccactgcact ctaactgagt actaaggcca      1980
     ctagggcttt ctagacctcg ctttcccctt gagcttcctg gggaggtgaa gtgaggtgtg      2040
     tgtgtgtgtg tgtgtctttg tgtgcttaga tttattgcag ggaaaggtct aatccagaat      2100
     cagtattcag gctttgtcat gttgtatcag tgccaaggtg accctcaagg tcatgtaact      2160
     taagcaaagc ttagcattta ttttattcct gaaaacttaa gtattttact tttttgtgtg      2220
     ttcgtggaga catttgcagt attaatgatt ttatttttcc taaatcggga tggaaacaaa      2280
     cttttccagg ttatgttaat aagccactta agtgccttaa acagctttgg tgtagatgag      2340
     aattgctggg tccgtcatgg atcctgatag gcagacgtgt tgaggttctc aaagaggctg      2400
     catttgttgt gggaaggcac actttcagcc agcactcttt ctgggaaagt ccttttgtgc      2460
     gtctgggcac ctcagaactt ccttgaagtg atgggtaaag gctgtgacta tgggcacctg      2520
     gggtgacact ggcctccttg tccaccttgg agtctggctg gttcccagct gagagaacct      2580
     tactgctctt ggctagaaga ttgacacact caatctctct tgaaactctc ttaagtgtgt      2640
     ttgcagttat gttgattgag ttgttgaaga cagtgcttag gtgaggaact tgggcaagcc      2700
     cagcagtcca ccatctttct cctgtgactt gtgtcctaac ctgctagact ctgtcctgac      2760
     ctgagcagca tgaaagacct ccacatccct agagcagtga tggatacagt caggcaagga      2820
     aaccaagtga gggttggggg ggataccaag aatagaagga ctaggaggcc ctcaacaagg      2880
     gccaagcgag tcaaggctgc tctctgcaga cactggcagg tccagagaat aatggtggct      2940
     tagcagaggc tcagggaagg atcagtagga agaagggtgg ctgtgaggta ggtccccatg      3000
     aaggagacat agttcacctg tagagtgaaa gccctagcaa gacttgcaga gctttgttca      3060
     ttgcacctaa gccctctttg aaaagaagca agggagctca tacttattcc tctgaggcaa      3120
     gttcacttcc agcagtagga gagcgagcca gccaaatgca gctgggcacc cacctgtatg      3180
     cttgccattt acccattccc acagcaggga tggaagagct ggggccatgt agttgattcc      3240
     ttgatcaagt ctcctgatag gaacgtgatc actcagatgg ctgcccacct aatagctagg      3300
     tattgcttaa cttgaaggcc tgctgccttc cggggggggg gggggtgtca gaatccagca      3360
     tcctcagtgc catctcaaca cagggtgtgg ttgttggtcc agcctgcctg tagcagtgac      3420
     cttcatagag ggagataaat tgattttggt tttctcccat ttttgctaac ctgatcattg      3480
     ctggtaagag tggaatttgg gcctccttgg tggtctggat tcatactcgc atgtaaagat      3540
     gtgccaaata tcaaggcctc agtgtaaagg gaagcccctt tcccaggctt gtctgagtgc      3600
     ctcccccacc cttccccctg tctggcaatg gtctgggacc aacatcaggc actgctccat      3660
     cctgatctag tggccaagga agaccacatt ctcctactgt tgagggctgg ccttgagcga      3720
     gttcctaggt acagagaact ctttttgtct ggactggagt tgccagtacc aagcctacaa      3780
     gacttgttgg ccacctcctc ctcagagtct cttcccaaaa gaatccccta gccaggataa      3840
     tgggtggctt agtagaggct cagggaagga acagggagaa gggtggctgt gagctcaagt      3900
     ccccctcttt gccaccatca cattgtgtga gcggaaccag tcactgcacc tctcaggcct      3960
     cagggaaagg catggagggc atgcatagca ttaccaggag ctgccagagc acgggagccc      4020
     atcctccacc agcagcagag aggggttaag tattattagt gtctattctt aaaattaagt      4080
     gggctggaac agagctgagt tacaggcgcc agtgtcttac acagatacaa aagctgaagc      4140
     cgtcagcctg cctttgcagg tacagctgcc tcccaaccaa ggcctggagg cgttaagagg      4200
     tgggagggca caagcaggct ttcaggagtg ttgaagcaag ggatctgcag catagctttg      4260
     ggcgtctcca gaactcatgg tgagggaggc accaacacct agaggtctta aaagccctgc      4320
     attcaccatg atctgtctgc ccctgccctt ttgggttctt ctgcatgcag tgcccccctc      4380
     tcctgatgct aagttttggc atgggtgtcc tggctacctc aactgtattc tcaaggccag      4440
     gaggatggct ctggccatac ttacggaagc caggccaatt tgtgtgaagc aagctgggct      4500
     tctggtttga ttcagcttct gtagcctcca gggaccatcc tctggagtct tgtgctttca      4560
     ctggactctt cagcttcacc aaacacacca agctttgcca tttacatgcc atgtgggcct      4620
     tgccaagggt tatttcaggg gtcttcctgg gagtcttgtt ctaagacacc gtgtttcttt      4680
     agtcttaggg acaactccca aggtgatgag ctcataggac gtcttcccat ggggccctgt      4740
     actggtgtca ataaaccata tattcaagaa aaaaaaaaaa aaa                        4783
//


spacer
spacer