spacer

EBI Dbfetch

ID   BC042470; SV 1; linear; mRNA; STD; MUS; 3669 BP.
XX
AC   BC042470;
XX
DT   07-JAN-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus natriuretic peptide receptor 2, mRNA (cDNA clone MGC:30424
DE   IMAGE:5137261), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3669
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3669
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2ea7aa4adda5e6181cde17d2ca6b70f4.
DR   Ensembl-Gn; ENSMUSG00000028469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030191; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 41 Row: o Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31341079.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3669
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:30424 IMAGE:5137261"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3669
FT                   /gene="Npr2"
FT                   /note="synonyms: GC-B, mNPR-B, GC-B2, GC-B3"
FT   CDS             251..3394
FT                   /codon_start=1
FT                   /gene="Npr2"
FT                   /product="natriuretic peptide receptor 2"
FT                   /db_xref="GOA:Q6VVW5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001170"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:97372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6VVW5"
FT                   /protein_id="AAH42470.1"
FT                   /translation="MALPSLLLVVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRV
FT                   GPAVALAVEALGRALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYP
FT                   AASVARFASHWRLPLLTAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWT
FT                   ARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGR
FT                   IVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQE
FT                   QAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDG
FT                   ILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGD
FT                   LDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAI
FT                   VALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSRLTL
FT                   SLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQF
FT                   NHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLH
FT                   NSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSG
FT                   NPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSID
FT                   RTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNL
FT                   EKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFT
FT                   ALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEI
FT                   ARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASR
FT                   MESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQKGPPGLL"
FT   misc_difference 970
FT                   /gene="Npr2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2740
FT                   /gene="Npr2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3661..3669
FT                   /gene="Npr2"
FT                   /note="polyA tail: 9 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3669 BP; 817 A; 1028 C; 984 G; 840 T; 0 other;
     cttctgccac cctatcctta gtccctggac ctggctgtgg gctggtagcc cactccttcc        60
     cgacccaggt ttccccccat cctcttcttg cgtggtcccc agcactttct gtatccgggc       120
     cgactaagct tgcccccact tctcttcctg gccctcttcc ccaggctcca ggctgggtgg       180
     cgcttgtgcc tgcccagtag gccagagcgg cccctggttc gggggaccgt gggtcagctg       240
     ctctatcccc atggcactgc catccctgct gctggtggtg gcagccctgg caggtggggt       300
     gcgtcctccg ggggcacgga acctgacgct ggcggtggtg ctgccagaac acaacctgag       360
     ctatgcctgg gcctggccac gggtgggtcc tgctgtggca ctggctgtgg aggcactggg       420
     ccgggcactg cccgtggacc tgcggtttgt cagctccgaa ctagacggcg cctgctctga       480
     gtacctggca ccactgcgcg ctgtggacct caagctgtac catgaccccg accttctgtt       540
     gggccccggt tgtgtgtacc ccgctgcctc tgtggctcgc tttgcctcac actggcgcct       600
     tcccctcctg actgcggggg cagtggcctc tggctttgca gctaagaatg agcattatcg       660
     taccctggtt cgcactggcc cctctgcgcc caagctgggt gagtttgtag tgacattgca       720
     cgggcacttc aattggacag ctcgggctgc tttgctgtat ctggatgctc gcacagatga       780
     ccggccccac tacttcacca tcgagggcgt ctttgaggcc ctgcagggca gcaacctcag       840
     tgtgcagcac caggtgtatg cccgagagcc aggtggccct gagcaagcca cccacttcat       900
     cagagccaac gggcgcattg tgtatatctg cggccccctg gaaatgctgc atgagatcct       960
     gcttcaggct cagagggaga acctgaccaa tggggactat gtcttctttt accttgatgt      1020
     ctttggggag agtctccgag caggccccac ccgtgcaaca ggccggccat ggcaggacaa      1080
     tcgaacccag gaacaggccc aggccctcag agaggccttt cagactgtat tggtgatcac      1140
     ataccgagaa cccccaaatc ctgagtatca ggagtttcag aatcgcctgc tgatcagagc      1200
     ccgggaagac tttggtgtgg agctggcccc atccctgatg aaccttattg ctggctgctt      1260
     ctatgatggg atcctgctct atgcccaagt cctgaatgag actatacagg aagggggtac      1320
     cagggaagat ggacttcgaa ttgtggagaa gatgcaggga cgaagatacc atggtgtaac      1380
     tggactggtt gtcatggaca agaacaatga ccgcgagact gatttcgtcc tgtgggccat      1440
     gggagacttg gattctgggg actttcagcc cgcagcccat tactctggag cagagaagca      1500
     gatttggtgg acaggccggc caattccctg ggtgaagggg gccccacctt tggacaatcc      1560
     cccctgtgcc tttgacttgg acgacccatc ctgtgataaa actccacttt ccactctggc      1620
     aatcgtggcc ctgggcacgg gagtcacctt catcatgttt ggtgtttcca gtttcctaat      1680
     tttccggaag ctgatgctgg agaaggagct ggctagcatg ctatggcgca ttcgctggga      1740
     agaactgcag tttggcaact cggatcgcta tcacaagggt gcaggcagtc gcctgacgct      1800
     gtcgctgcgg ggatccagtt acggctcgct catgacagcc catgggaaat accagatctt      1860
     tgccaacacc ggtcacttca agggaaatgt tgttgccatc aaacacgtga ataagaagcg      1920
     catcgagctg acccggcaag ttctgtttga actcaaacac atgagagatg tccagttcaa      1980
     ccatcttact cgcttcatcg gagcctgcat agaccctccc aacatctgca ttgtcaccga      2040
     gtattgtcct cgtgggagct tacaagatat tctagaaaat gacagcatca atttggactg      2100
     gatgtttcgc tactcgctca tcaatgacct tgtgaagggt atggcctttc tccacaacag      2160
     cattatttca tctcatggaa gcctcaagtc ctccaactgt gtggtggata gtcgatttgt      2220
     gctcaaaata acagattacg gtctggctag tttccgatca actgctgaac cggacgacag      2280
     ccatgccctc tatgccaaga agctgtggac tgccccagaa ctgcttagcg ggaacccctt      2340
     gccaaccaca ggcatgcaga aagcagatgt ctacagcttt gccatcattc tacaggaaat      2400
     agcacttcga agtggtcctt tctacttgga aggcctggac ctcagtccca aggagattgt      2460
     ccagaaggtg cggaatggtc agaggccgta tttccggcca agcattgacc ggacacaact      2520
     gaatgaagag ttagttttgc tgatggagag atgctgggcc caggacccaa cagaacgtcc      2580
     agactttggg caaatcaagg gcttcattcg ccggtttaac aaggaaggtg gtaccagcat      2640
     attggacaac ctcttgctgc gcatggaaca gtatgctaat aacctggaaa agctggtgga      2700
     ggaacgcaca caggcctatc tagaggagaa acgcaaagca gaggccctgc tgtaccaaat      2760
     tctaccccat tctgtagcag agcagttaaa gcggggagag acggttcagg cggaggcctt      2820
     cgacagcgtc accatctact tcagtgacat cgtgggcttc acagcgctgt cagctgagag      2880
     cacccccatg caggtggtga cacttcttaa tgacctttat acctgctttg atgccattat      2940
     cgacaacttt gatgtctaca aggtggaaac cattggggat gcctacatgg tggtatctgg      3000
     ccttccaggc cgaaacggtc agcgccatgc accagaaatt gctcgaatgg ccctagcatt      3060
     gctagatgct gtctcttcct tccgcatccg ccatcgaccc catgaccagc tgaggttacg      3120
     cataggtgtc catactgggc cagtctgtgc tggggtggtt ggcctgaaga tgccccggta      3180
     ctgtcttttt ggagacacag taaacactgc ttctcgaatg gagtcgaatg gccaagctct      3240
     aaagatccat gtctcctcga ccaccaagga cgccctggat gagctgggat gcttccagct      3300
     cgagctccgt ggggatgtgg agatgaaggg aaaaggaaaa atgcgaactt actggctctt      3360
     gggagagcaa aagggacctc ccggactcct gtaaagccca ggccggccat cttctgctgc      3420
     tggtacttgg atgggcaatg gtcactgtgt ttccacacag caaaaacaga cgtagccata      3480
     tcagatggaa aacatgcata gacacaaacc ccctgcctta tgtggaaatc atagccccct      3540
     gccgctcagc cttgtacata gacctatccc tccctgccct ggtcctcttc ctgcctcctg      3600
     taaatatctg tatctagacc agaatatttt gtccaagtat aaaacaacaa caacaaaaaa      3660
     aaaaaaaaa                                                              3669
//


spacer
spacer