Dbfetch

ID   BC040704; SV 1; linear; mRNA; STD; HUM; 1265 BP.
XX
AC   BC040704;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   27-MAY-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Homo sapiens chromosome 7 open reading frame 27, mRNA (cDNA clone
DE   IMAGE:5740490), complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1265
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1265
RA   Strausberg R.;
RT   ;
RL   Submitted (29-NOV-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 00a2ba5620c7f8e93557c8b90bc1c54e.
DR   Ensembl-Gn; ENSG00000106009; homo_sapiens.
DR   Ensembl-Tr; ENST00000340611; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 89 Row: f Column: 8
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1265
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_88"
FT                   /clone="IMAGE:5740490"
FT                   /tissue_type="Duodenum, adenocarcinoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1265
FT                   /gene="C7orf27"
FT                   /note="synonym: MGC22916"
FT   CDS             187..1062
FT                   /codon_start=1
FT                   /product="C7orf27 protein"
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="H-InvDB:HIT000052446.14"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="AAH40704.1"
FT                   /translation="MGKLRIGGPCAHCAAWEGVRAGCGPRLHVRGQPPSCTGVLLREPR
FT                   SCHTTNHPHLLPVPQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQF
FT                   VATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALR
FT                   ALCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATL
FT                   PRWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGG
FT                   FLQGDEADCY"
XX
SQ   Sequence 1265 BP; 223 A; 405 C; 408 G; 229 T; 0 other;
     gtgtgctcgt ttgcttgcgg gtggtcgagc ggccagcatg cagcgtggga gcagctgctg        60
     ctgtgggcag cgcctgcagc agtgactgcc gaggccctgg ggctgtgctg ggtgtgggac       120
     ctgtgcgctt cgccttctgt ctccccagca cccctccact tagacatggt tacctccatt       180
     tgacagatgg gtaaactgag gattggaggg ccgtgtgctc actgcgcagc atgggaaggt       240
     gtcagagcgg gctgtggccc tagactgcat gtccggggcc agcccccatc atgtaccgga       300
     gtcctgttgc gggagcctcg ctcctgccac accaccaacc atccgcactt gctccctgtc       360
     ccccagagcc tgttcctgga gctcctgcac atcctctccg tagactcgga gggcttccca       420
     cggcgggcgg tcatgcaagt cttcactgag tggctgcggg acggccacgc cgacgcggcc       480
     caggacacgg agcagttcgt ggccactgtg ctgcaggcgg cgagccggga cctggactgg       540
     gaggtccgcg cccagggcct ggagctggcc ctcgtgttcc tgggccagac tttggggccg       600
     ccgcgtaccc actgccccta tgccgtggcc ctacccgagg tggccccagc ccagccactc       660
     accgaggcac tgagggctct ctgccacgtg gggctctttg acttcgcctt ttgtgccttg       720
     tttgactgcg accgccctgt ggcgcagaag tcttgtgacc tccttctctt cctgagggac       780
     aagattgctt cctacagcag cctgcgggag gccaggggca gccccaacac tgcctccgca       840
     gaggccaccc tgccgaggtg gcgggcgggt gagcaggccc agcccccagg ggaccaggag       900
     cctgaggctg tgctggccat gctcaggtcc ctagacctgg agggcctgcg gagcacgctg       960
     gccgagagca gcgaccacgt ggagaagagt ccccagtccc tcctgcagga catgctggcc      1020
     acgggaggct tcctgcaggg ggacgaggcc gactgctact gagcagaacc agagtctgcc      1080
     actggggctc aggaccaagg gaggcagcac catgtccttc tgtgggacac tgccagcccc      1140
     agggctccag cccagcccgg tggatcctct ggggaagcca ggaccaggag agaagcaagg      1200
     tcaagaaatc ccacagtttg atgtattaaa gaaatgactt atttctactc aaaaaaaaaa      1260
     aaaaa                                                                  1265
//