spacer

EBI Dbfetch

ID   BC040243; SV 1; linear; mRNA; STD; MUS; 2441 BP.
XX
AC   BC040243;
XX
DT   02-DEC-2002 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus lectin, galactose binding, soluble 8, mRNA (cDNA clone
DE   MGC:6442 IMAGE:2582159), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2441
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2441
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-NOV-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a535821372f5970e4556e0ec8d2f454f.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124888; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 5 Row: e Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543121.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2441
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:6442 IMAGE:2582159"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2441
FT                   /gene="Lgals8"
FT                   /note="synonym: Lgals-8"
FT   CDS             248..1198
FT                   /codon_start=1
FT                   /gene="Lgals8"
FT                   /product="lectin, galactose binding, soluble 8"
FT                   /db_xref="GOA:Q9JL15"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JL15"
FT                   /protein_id="AAH40243.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   misc_difference 2404..2441
FT                   /gene="Lgals8"
FT                   /note="polyA tail: 38 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2441 BP; 730 A; 532 C; 572 G; 607 T; 0 other;
     cactgttccc ggaccggaat ccgagtgtgg acacggcatc ccgccgtctc ctccgtgaca        60
     catgcacggg gcaccggaca ccgggagcga tcgtgggttg aggcttgtac tgggaccgta       120
     gtgtcgggac aacgctgact gctgcggaca agtttttact ttgagtaatc cttaaatgaa       180
     gagtgggtaa agtgtgtata cggaagagag actccaatca acaatatcaa taagttgaaa       240
     aagaaaaatg ttgtccttaa ataacctaca aaatatcatc tataacccga taatccccta       300
     tgttggcacc attactgagc aattgaagcc tggctctctg attgtaatcc gtgggcatgt       360
     ccctaaagat tcagaaagat tccaggttga ctttcagctg ggcaacagcc tgaagccaag       420
     agcagacgtg gccttccact ttaaccctcg gttcaaaagg tctagctgca ttgtttgtaa       480
     cacactgaca caggagaagt ggggctggga ggagatcacc tacgacatgc ccttcagaaa       540
     agaaaagtcc tttgagatcg tgttcatggt gctcaagaac aaattccagg tggctgtgaa       600
     cggaaggcat gttctgctgt acgcccacag gatcagcccg gagcagatcg acacagtggg       660
     catctacggc aaagtgaaca tccactccat cgggttcaga ttcagctcgg atttacagag       720
     tatggaaaca tctgctctgg gactgacaca gataaacaga gagaatatac aaaagccagg       780
     caagctccag ctgagcctgc catttgaagc aaggttgaat gcctccatgg gtcctggacg       840
     aaccgttgtc attaaagggg aagtgaacac caatgcccga agctttaatg ttgacctagt       900
     ggcaggaaaa acaagggata tcgctctgca cttgaaccca cgcctcaatg tgaaagcatt       960
     tgtaagaaat tcctttcttc aggatgcctg gggagaagag gagagaaata ttacctgctt      1020
     cccatttagt tctgggatgt actttgagat gataatctac tgtgatgtcc gggaattcaa      1080
     ggttgctata aatggtgtgc acagcctgga gtacaaacac agatttaaag acctaagcag      1140
     tattgataca ctatcagtcg atggtgatat ccgtttgctg gatgtaagga gctggtagct      1200
     accatgactg ccaaaacccc cgaaatacaa aatggcttat ccggtactgg ccatgtcaaa      1260
     tgcatctcgc tttcaccata ttgtttatat tgctaagttg agctcctcca acatcaagtc      1320
     ctactggtgt tgtcaggtct ggccatgcag tacattcaga ggaacagagc cggggcaatc      1380
     acagctcact gccagagagg ctctgcacac tgggtccctc ttataaacca cactcagcaa      1440
     atatttaagt gcctaatata ctacatatac tagctaatag ggatggcaag catacttcct      1500
     ttgtatattc tctgagccgg gcacagacat ggcagggccc agaacttgtg tggtccatgt      1560
     tttctagcac ttcgtaccag tttctggcct cctaatgtag ggtcttcttg ctggcattgc      1620
     attaacccca ctaggggcct ttgcagttaa ggtcagaaaa atatactaat ggatggcaaa      1680
     cactacttcc ccagcaaccc ttttcataat cagcattcta tcatatctca taattgaaga      1740
     ctgcatagca tttacttagc tctcaccgct ttaaacttta taaaatgtat gatgctgaac      1800
     acagcagaaa aactgaggcc aaaaccctga attatgacaa aacaagtgtt ctgctccaag      1860
     cagatttctg ctggttgatt ggcgctcaag tccagggtgt gtgggtacct gtggcaaagt      1920
     aaggcagaag ttggataaac cgtgtgtgta aaaccctctt ggacgtatat ataaaacaag      1980
     cactatcaaa gcaaacccag gggcgtagtg tgaaaggctt agttggtgtg gagactagcc      2040
     ctcgtgcctt tgggtctgaa gatgtcggtc tgcagcagca gcgaggtcag gcacattaaa      2100
     ccacaggaca gaattctgct ggggtttagg agtattcagc caatctgctt agatatatgc      2160
     acttgtgcat atgaaataat accatcagca gtcttactca aggcagcaac tgctagtcct      2220
     tcattttcat gcaaatttat tatgttcact cttcaatatg gggtggtggg tggaactggg      2280
     taatttgtac ggaggccagg aggctctaga attctccaga gttatgtctt cataaagaat      2340
     gagtcttcat aaagaatgca ctactgagat attgggggct caaaggcact caggaaaaaa      2400
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a                          2441
//


spacer
spacer