Dbfetch

ID   BC039177; SV 1; linear; mRNA; STD; MUS; 1040 BP.
XX
AC   BC039177;
XX
DT   30-NOV-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus ubiquitin carboxy-terminal hydrolase L1, mRNA (cDNA clone
DE   MGC:25237 IMAGE:4506229), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1040
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1040
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-NOV-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bab83f14ef0e52790c01f822a025fbf3.
DR   Ensembl-Gn; ENSMUSG00000029223; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029590; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029558; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029506; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029567; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029290; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030021; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028698; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029259; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029490; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029393; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030054; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028422; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028778; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031131; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072010; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071923; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071581; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072414; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072123; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071534; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071674; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071572; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071723; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071597; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072612; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070733; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: m Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6755928.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1040
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:25237 IMAGE:4506229"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1040
FT                   /gene="Uchl1"
FT                   /note="synonym: PGP9.5"
FT   misc_difference 1..8
FT                   /gene="Uchl1"
FT                   /note="8 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 10
FT                   /gene="Uchl1"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   misc_difference 12
FT                   /gene="Uchl1"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   CDS             36..707
FT                   /codon_start=1
FT                   /gene="Uchl1"
FT                   /product="ubiquitin carboxy-terminal hydrolase L1"
FT                   /db_xref="GOA:Q9R0P9"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="MGI:MGI:103149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0P9"
FT                   /protein_id="AAH39177.1"
FT                   /translation="MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSP
FT                   ACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQD
FT                   KLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFI
FT                   LFNNVDGHLYELDGRMPFPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKA
FT                   A"
FT   misc_difference 1011..1040
FT                   /gene="Uchl1"
FT                   /note="polyA tail: 30 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1040 BP; 250 A; 283 C; 288 G; 219 T; 0 other;
     cggacgcgtg gggtctgcag gtgccatccg cgaagatgca gctgaagccg atggagatta        60
     accccgagat gctgaacaaa gtgttggcca agctgggggt cgccggccag tggcgcttcg       120
     ccgacgtgct agggctggag gaggagactc tgggctcagt gccatcccct gcctgcgccc       180
     tgctgctcct gtttcccctc acggcccagc atgaaaactt caggaaaaag caaattgagg       240
     aactgaaggg acaggaagtt agccctaaag tttacttcat gaagcagacc atcggaaact       300
     cctgtggtac catcgggttg atccacgcag tggccaacaa ccaagacaag ctggaatttg       360
     aggatggatc cgtcctgaaa cagtttctgt ctgaaacgga gaagctgtcc cccgaagata       420
     gagccaagtg tttcgagaag aacgaggcca tccaggcggc ccatgactcc gtggcccagg       480
     agggccagtg tcgggtagat gacaaagtga atttccattt tattctgttc aacaacgtgg       540
     acggccatct gtacgagctc gatgggcgaa tgccctttcc agtgaaccat ggcgccagct       600
     cagaggactc tctgctgcag gatgctgcca aggtctgcag agaattcact gagcgcgagc       660
     agggggaggt ccgcttctct gccgtggctc tctgcaaagc agcttaagtc tggggagaga       720
     gaaccagccg atcccccctt ccctgggcag gtgcgcgcgg cccgcccttg gtttgcagct       780
     ttagcactta gaaccacagc tgtcttcttg cgttctacag ccccatcccc tccaccccac       840
     ccaggccacc agggggctct gtcacagcca caccaggctg agcactttcc ctcctgtgtg       900
     tctcgtacct tgctctctac ggtctctttg gtttctgtct gtaagttacg gccctggatg       960
     tggtttgtct agtccttaag aggaagaata aaactttgct ggtgagagta aaaaaaaaaa      1020
     aaaaaaaaaa aaaaaaaaaa                                                  1040
//