Dbfetch

ID   BC038939; SV 1; linear; mRNA; STD; MUS; 1295 BP.
XX
AC   BC038939;
XX
DT   07-NOV-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus STIP1 homology and U-Box containing protein 1, mRNA (cDNA
DE   clone MGC:46850 IMAGE:2598940), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1295
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1295
RA   Strausberg R.;
RT   ;
RL   Submitted (01-NOV-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; e665413756c4551693acf9fdc8706cd9.
DR   Ensembl-Gn; ENSMUSG00000039615; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023373; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023298; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023337; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023097; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022599; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023202; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023172; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023279; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023819; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022348; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022662; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000044911; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046240; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0046213; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0046164; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046175; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045906; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046011; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045839; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045953; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045926; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0046063; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045899; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046744; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045281; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 80 Row: a Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 9789906.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1295
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:46850 IMAGE:2598940"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1295
FT                   /gene="Stub1"
FT                   /note="synonym: Chip"
FT   CDS             98..1012
FT                   /codon_start=1
FT                   /product="Stub1 protein"
FT                   /db_xref="GOA:Q9WUD1"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1891731"
FT                   /db_xref="PDB:2C2L"
FT                   /db_xref="PDB:2C2V"
FT                   /db_xref="PDB:3Q47"
FT                   /db_xref="PDB:3Q49"
FT                   /db_xref="PDB:3Q4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUD1"
FT                   /protein_id="AAH38939.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
FT   misc_feature    278..370
FT                   /note="TPR; Region: TPR Domain"
FT   misc_feature    788..979
FT                   /note="Ubox; Region: Modified RING finger domain"
XX
SQ   Sequence 1295 BP; 300 A; 355 C; 400 G; 240 T; 0 other;
     ccacgcgtcc gcccacgcgt ccgcccacgc gtccggctgc gcgggctgcg agatctaggt        60
     ggccgggcgc ggagcccaag ccgtgccgcg cggcgccatg aagggcaagg aggaaaagga       120
     gggcggcgcg cggctgggca ctggtggcgg cggcagccct gataagagcc cgagtgcgca       180
     agagctcaag gagcagggaa accggctctt cgtgggccgc aagtacccgg aggcggcggc       240
     ctgctacggc cgcgccatca ctcggaaccc acttgtggca gtgtactaca ctaaccgggc       300
     cctgtgctat ctgaagatgc agcagcctga acaggcactt gctgactgcc ggcgagccct       360
     ggagctggac gggcagtctg tgaaggcgca cttcttcctg gggcagtgcc agctggagat       420
     ggagagttat gatgaggcca ttgccaatct gcagcgagcc tatagtttgg ccaaggagca       480
     gcgactcaac tttggggatg atattcctag tgcccttcgc attgctaaga agaagcgctg       540
     gaacagtatc gaggaacggc gcatccacca ggagagtgag ctgcattcat atctcaccag       600
     gctcattgct gctgagcgag agagggaact ggaggagtgt cagcggaacc acgagggtca       660
     tgaagatgat ggccacatcc gggcccagca ggcctgcatt gaggccaagc acgataaata       720
     catggcagat atggatgagc tcttctctca ggtggacgag aaaagaaaga agcgagatat       780
     ccctgactac ttgtgtggca agattagctt tgagctgatg cgggaaccct gcattacacc       840
     cagtggtatc acctatgacc gcaaggacat tgaggagcac ctgcagcgtg tgggccactt       900
     tgaccctgtg acccggagcc ctctgaccca ggaacagctc atccccaact tggccatgaa       960
     ggaagtcatt gacgctttca tctctgagaa cggctgggta gaggactatt gaggccccat      1020
     gtcctgcctg gcaccctggc ccaggaggat ctggagacgg aagctccagt ccctgtatag      1080
     tttgtgtccc tgggcctgcc cccatcggcc ctgctgatgg gttctgaact gctccccttc      1140
     tcagcatacc ccttgctgga ccatgagcct cccttgtccc ccttctgggc tggagagtgg      1200
     gtgagggtgg gctgaggttg ctgctgctgc cactgtcctg taataaagtc tgtgagcact      1260
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa                                 1295
//