Dbfetch

ID   BC038939; SV 2; linear; mRNA; STD; MUS; 1260 BP.
XX
AC   BC038939;
XX
DT   07-NOV-2002 (Rel. 73, Created)
DT   20-JAN-2018 (Rel. 135, Last updated, Version 9)
XX
DE   Mus musculus STIP1 homology and U-Box containing protein 1, mRNA (cDNA
DE   clone MGC:46850 IMAGE:2598940), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1260
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1260
RA   Strausberg R.;
RT   ;
RL   Submitted (01-NOV-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-1260
RA   Strausberg R.;
RT   ;
RL   Submitted (18-JAN-2018) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 290b53b1b1084ba55bf467d34ce9a5a2.
DR   Ensembl-Gn; ENSMUSG00000039615; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023373; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023298; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023337; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023097; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022599; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023202; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023172; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023279; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023819; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022348; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022662; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000044911; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046240; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0046213; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0046164; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046175; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045906; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046011; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045839; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045953; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045926; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0046063; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045899; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046744; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045281; mus_musculus_wsbeij.
XX
CC   On Jan 18, 2018 this sequence version replaced BC038939.1.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 80 Row: a Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 9789906.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1260
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:46850 IMAGE:2598940"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1260
FT                   /gene="Stub1"
FT                   /gene_synonym="Chip"
FT   CDS             63..977
FT                   /codon_start=1
FT                   /gene="Stub1"
FT                   /gene_synonym="Chip"
FT                   /product="Stub1 protein"
FT                   /db_xref="GOA:Q9WUD1"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1891731"
FT                   /db_xref="PDB:2C2L"
FT                   /db_xref="PDB:2C2V"
FT                   /db_xref="PDB:3Q47"
FT                   /db_xref="PDB:3Q49"
FT                   /db_xref="PDB:3Q4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUD1"
FT                   /protein_id="AAH38939.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
FT   misc_feature    243..335
FT                   /gene="Stub1"
FT                   /gene_synonym="Chip"
FT                   /note="TPR; Region: TPR Domain"
FT   misc_feature    753..944
FT                   /gene="Stub1"
FT                   /gene_synonym="Chip"
FT                   /note="Ubox; Region: Modified RING finger domain"
XX
SQ   Sequence 1260 BP; 297 A; 335 C; 391 G; 237 T; 0 other;
     gctgcgcggg ctgcgagatc taggtggccg ggcgcggagc ccaagccgtg ccgcgcggcg        60
     ccatgaaggg caaggaggaa aaggagggcg gcgcgcggct gggcactggt ggcggcggca       120
     gccctgataa gagcccgagt gcgcaagagc tcaaggagca gggaaaccgg ctcttcgtgg       180
     gccgcaagta cccggaggcg gcggcctgct acggccgcgc catcactcgg aacccacttg       240
     tggcagtgta ctacactaac cgggccctgt gctatctgaa gatgcagcag cctgaacagg       300
     cacttgctga ctgccggcga gccctggagc tggacgggca gtctgtgaag gcgcacttct       360
     tcctggggca gtgccagctg gagatggaga gttatgatga ggccattgcc aatctgcagc       420
     gagcctatag tttggccaag gagcagcgac tcaactttgg ggatgatatt cctagtgccc       480
     ttcgcattgc taagaagaag cgctggaaca gtatcgagga acggcgcatc caccaggaga       540
     gtgagctgca ttcatatctc accaggctca ttgctgctga gcgagagagg gaactggagg       600
     agtgtcagcg gaaccacgag ggtcatgaag atgatggcca catccgggcc cagcaggcct       660
     gcattgaggc caagcacgat aaatacatgg cagatatgga tgagctcttc tctcaggtgg       720
     acgagaaaag aaagaagcga gatatccctg actacttgtg tggcaagatt agctttgagc       780
     tgatgcggga accctgcatt acacccagtg gtatcaccta tgaccgcaag gacattgagg       840
     agcacctgca gcgtgtgggc cactttgacc ctgtgacccg gagccctctg acccaggaac       900
     agctcatccc caacttggcc atgaaggaag tcattgacgc tttcatctct gagaacggct       960
     gggtagagga ctattgaggc cccatgtcct gcctggcacc ctggcccagg aggatctgga      1020
     gacggaagct ccagtccctg tatagtttgt gtccctgggc ctgcccccat cggccctgct      1080
     gatgggttct gaactgctcc ccttctcagc ataccccttg ctggaccatg agcctccctt      1140
     gtcccccttc tgggctggag agtgggtgag ggtgggctga ggttgctgct gctgccactg      1200
     tcctgtaata aagtctgtga gcactaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1260
//