spacer

EBI Dbfetch

ID   BC038631; SV 1; linear; mRNA; STD; MUS; 1793 BP.
XX
AC   BC038631;
XX
DT   01-NOV-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus chemokine (C-C motif) receptor-like 2, mRNA (cDNA clone
DE   MGC:47919 IMAGE:1347006), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1793
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1793
RA   Strausberg R.;
RT   ;
RL   Submitted (15-OCT-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 81da64f3b4064b667a0af5fa69190155.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Marcello Bento Soares, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 83 Row: b Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8567367.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1793
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Soares_mammary_gland_NbMMG"
FT                   /clone="MGC:47919 IMAGE:1347006"
FT                   /tissue_type="Mammary gland"
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..1793
FT                   /gene="Ccrl2"
FT                   /note="synonyms: L-CCR, E01, CCR11"
FT   CDS             178..1260
FT                   /codon_start=1
FT                   /product="Ccrl2 protein"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35457"
FT                   /protein_id="AAH38631.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPR
FT                   EGHGRPIELYSNLHQRQDII"
FT   misc_feature    340..1089
FT                   /note="7tm_1; Region: 7 transmembrane receptor (rhodopsin
FT                   family)"
XX
SQ   Sequence 1793 BP; 442 A; 451 C; 412 G; 488 T; 0 other;
     ctgtccccaa cctccttccc gactgatacc actcgcttcc aggttctctg cttgtcctcg        60
     tgcttgacca gcgcagtttc acttttgcaa acatctgttt atatcccttg agagaaaaat       120
     atcaagcaac ctgcctcaaa cgacgctgtt ttggccggtg agcaaggaca gcctccgatg       180
     gataactaca cagtggcccc ggacgatgaa tatgatgtcc taatcttaga cgactacctg       240
     gacaacagtg ggccggacca agttccggcc cccgagttcc tctcccccca gcaggtgctg       300
     cagttctgct gcgcggtgtt tgcggtgggt ctcttggaca acgtgctggc ggtgtttatc       360
     ttggtgaaat acaaaggact caagaatctg gggaacatct acttcctaaa cctggcactt       420
     tcaaacctgt gtttcctgct tcccctgccg ttctgggccc atactgcagc acacggggaa       480
     agccctggca acgggacctg taaagttctt gtcggactcc actcctcggg cttatacagc       540
     gaggtgtttt ccaacatcct cctccttgtg caaggataca gggtgttttc ccaagggcga       600
     ctggcctcca tcttcacgac agtgtcttgt ggtattgttg cgtgcatcct ggcatgggcc       660
     atggctactg cgctctcttt gcccgagtct gtgttttatg agcctcggat ggaaagacag       720
     aaacacaagt gtgcctttgg caaacctcac ttcttgccaa tcgaagcgcc gctctggaag       780
     tacgttctga cgtcaaaaat gatcatcttg gtacttgctt ttcctctgct ggtttttata       840
     atctgctgca ggcaactgag gagaaggcag agcttcaggg agagacagta cgacctccac       900
     aagccggctc ttgtcataac gggcgtgttc cttttgatgt gggcgcctta caacactgtg       960
     cttttcctgt ctgctttcca ggaacacttg tccctgcagg atgagaagag cagctaccac      1020
     ctggacgcaa gtgttcaggt cacacagctg gtagcgacca cccactgctg cgtcaacccg      1080
     ctgctctatt tgcttcttga ccggaaggcc tttatgagat accttcgcag cctgttccca      1140
     cggtgcaatg atatccccta tcaaagtagt ggaggctatc agcaagcgcc tccaagggaa      1200
     ggtcatggca ggcccattga actgtacagc aatttgcatc aaaggcagga tataatataa      1260
     tataaacact caaccttgtc tcttcacatt gttttatgcc atttttatat gtttgtataa      1320
     aaatagaata taagaggaaa gggggctggt taatgaacat ttactactaa gcgttgaatt      1380
     tgtctctggc acacggttaa gttatttata aaggtgaatt ccactcttcc tctttagcgt      1440
     ttgtccgcag tgtgggcgtg ggcggtgtgc attccataaa ctgaagctcg gtagttgtcc      1500
     aaagttacat aactataaag tggcaaaact gatgtgtaaa ctcagagatc actggcccca      1560
     gagtctgtga gttatccaag cgtgccagcc tttcagtaac tgtcagctag cagtggtggc      1620
     atgtctgtca tcccagcact ctaggaggcg gaggcaggag gcatctcaca aatgcaagta      1680
     taacctgact tcccccaacc tcaattcttt tttttttgtt attgttgttc atcaaaatac      1740
     atgcaataaa tatatatatt tttaaagcaa aaaaaaaaaa aaaaaaaaaa aaa             1793
//


spacer
spacer