spacer

EBI Dbfetch

ID   BC037696; SV 1; linear; mRNA; STD; MUS; 2731 BP.
XX
AC   BC037696;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus platelet-derived growth factor, C polypeptide, mRNA (cDNA
DE   clone MGC:46836 IMAGE:4008749), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2731
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2731
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-SEP-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 894db6992b6ea0c45901f01fd1227a90.
DR   Ensembl-Gn; ENSMUSG00000028019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029652; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 80 Row: f Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31560372.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2731
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu30"
FT                   /clone="MGC:46836 IMAGE:4008749"
FT                   /tissue_type="Mammary tumor metastatized to lung.
FT                   MMTV-LTR/Wnt1 model. Expression driven by an MMTV-LTR
FT                   enhancer."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2731
FT                   /gene="Pdgfc"
FT                   /note="synonym: PDGF-C"
FT   misc_difference 6
FT                   /gene="Pdgfc"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 11
FT                   /gene="Pdgfc"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   CDS             209..1246
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /product="platelet-derived growth factor, C polypeptide"
FT                   /db_xref="GOA:Q8CI19"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="MGI:MGI:1859631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CI19"
FT                   /protein_id="AAH37696.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDLC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
FT   misc_difference 319
FT                   /gene="Pdgfc"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 515
FT                   /gene="Pdgfc"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'L' in cDNA, 'I' in the mouse genome."
FT   misc_difference 610
FT                   /gene="Pdgfc"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 772
FT                   /gene="Pdgfc"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 931
FT                   /gene="Pdgfc"
FT                   /note="'A' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1431
FT                   /gene="Pdgfc"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1919
FT                   /gene="Pdgfc"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2076^2077
FT                   /gene="Pdgfc"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 2084
FT                   /gene="Pdgfc"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2202
FT                   /gene="Pdgfc"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2697..2731
FT                   /gene="Pdgfc"
FT                   /note="polyA tail: 35 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2731 BP; 786 A; 582 C; 620 G; 743 T; 0 other;
     ccacgcgtcc gcaaaaactg gagacacaga agagggctct aggaaaaact tttggatggg        60
     attatgtgga aactaccctg cgattctctg ctgccagagc cggccaggcg cttccaccgc       120
     agcgcagcct ttccccggct gggctgagcc ttggagtcgt cgcttcccca gtgcccgccg       180
     cgagtgagcc ctcgccccag tcagccaaat gctcctcctc ggcctcctcc tgctgacatc       240
     tgccctggcc ggccaaagaa cggggactcg ggctgagtcc aacctgagca gcaagttgca       300
     gctctccagc gacaaggagc agaacggagt gcaagatccc cggcatgaga gagttgtcac       360
     tatatctggt aatgggagca tccacagccc gaagtttcct catacatacc caagaaatat       420
     ggtgctggtg tggagattag ttgcagtaga tgaaaatgtg cggatccagc tgacatttga       480
     tgagagattt gggctggaag atccagaaga cgatctatgc aagtatgatt ttgtagaagt       540
     tgaggagccc agtgatggaa gtgttttagg acgctggtgt ggttctggga ctgtgccagg       600
     aaagcagacg tctaaaggaa atcatatcag gataagattt gtatctgatg agtattttcc       660
     atctgaaccc ggattctgca tccactacag tattatcatg ccacaagtca cagaaaccac       720
     gagtccttcg gtgttgcccc cttcatcttt gtcattggac ctgctcaaca acgctgtgac       780
     tgccttcagt accttggaag agctgattcg gtacctagag ccagatcgat ggcaggtgga       840
     cttggacagc ctctacaagc caacatggca gcttttgggc aaggctttcc tgtatgggaa       900
     aaaaagcaaa gtggtgaatc tgaatctcct aaaggaagag gtaaaactct acagctgcac       960
     accccggaac ttctcagtgt ccatacggga agagctaaag aggacagata ccatattctg      1020
     gccaggttgt ctcctggtca agcgctgtgg aggaaattgt gcctgttgtc tccataattg      1080
     caatgaatgt cagtgtgtcc cacgtaaagt tacaaaaaag taccatgagg tccttcagtt      1140
     gagaccaaaa actggagtca agggattgca taagtcactc actgatgtgg ctctggaaca      1200
     ccacgaggaa tgtgactgtg tgtgtagagg aaacgcagga gggtaactgc agccttcgta      1260
     gcagcacacg tgagcactgg cattctgtgt acccccacaa gcaaccttca tccccaccag      1320
     cgttggccgc agggctctca gctgctgatg ctggctatgg taaagatctt actcgtctcc      1380
     aaccaaattc tcagttgttt gcttcaatag ccttcccctg caggacttca ggtgtcttct      1440
     aaaagaccag aggcaccaag aggagtcaat cacaaagcac tgccttctag aggaagccca      1500
     gacaatggtc ttctgaccac agaaacaaat gaaatgaatg tagatcgcta gcaaactctg      1560
     gagtgacagc atttcttttc cactgacaga atggtgtagc ttagttgtct tgatatgggc      1620
     aagtgatgtc agcacaagaa aatggtgaaa aacacacact tgattgtgaa caatgcagaa      1680
     atacttggat ttctccaacc tgtttgcata gatagacaga tgctctgttt tctacaaact      1740
     caaagctttt agagagcagc tatgttaata ggaattaaat gtgccatgct gaaaggaaag      1800
     actgaagttt tcaatgcttg gcaacttctc cgcaatttgg aggaaaggtg cggtcatggt      1860
     ttggagaaag cacacctgca cagaggagtg gccttccctt cccttccctc tgaggtggtt      1920
     tctgtgtttc attgtgtata tttttatatt ctccttttga cattataact gttggctttt      1980
     ctaatcttgt taaatatttc tatttttacc aaaggtattt aatattcttt tttatgacaa      2040
     cctagagcaa ttatttttag cttgataatt ttttttctaa acagaattgt tatagccaga      2100
     agaacaaaga tgattgatat aaaaatcttg ttgctctgac aaaaacatat gtatttcttc      2160
     cttgtatggt gctagagctt agcgtcatct gcatttgaaa aaatggaatg gggaagtttt      2220
     tagaattggt aggtcgcagg gacagtttga taacaactgt actatcatca attcccaatt      2280
     ctgttcttag agctacgaac agaacagagc ttgagtaaat atggagccat tgctaaccta      2340
     cccctttcta tgggaaatag gagtatagct cagagaagca cgtccccaga aacctcgacc      2400
     atttctaggc acagtgttct gggctatgct gcgctgtatg gacatatcct atttatttca      2460
     atactagggt tttattacct ttaaactctg ctccatacac ttgtattaat acatggatat      2520
     ttttatgtac agaagtatat catttaagga gttcacttat tatactcttt ggcaattgca      2580
     aagaaaatca acataataca ttgcttgtaa atgcttaatc tgtgcccaag ttttgtggtg      2640
     actatttgaa ttaaaatgta ttgaatcatc aaataaaata atctggctat tttgggaaaa      2700
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a                                     2731
//


spacer
spacer