spacer

EBI Dbfetch

ID   BC037683; SV 1; linear; mRNA; STD; MUS; 1812 BP.
XX
AC   BC037683;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus regulator of G-protein signaling 5, mRNA (cDNA clone MGC:46953
DE   IMAGE:3962083), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1812
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1812
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-SEP-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 15e49f3a57da8547d4a3a38218137982.
DR   Ensembl-Gn; ENSMUSG00000026678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027997; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 80 Row: d Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 29336054.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1812
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:46953 IMAGE:3962083"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1812
FT                   /gene="Rgs5"
FT   misc_difference 1..9
FT                   /gene="Rgs5"
FT                   /note="9 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             65..610
FT                   /codon_start=1
FT                   /gene="Rgs5"
FT                   /product="regulator of G-protein signaling 5"
FT                   /db_xref="GOA:O08850"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1098434"
FT                   /protein_id="AAH37683.1"
FT                   /translation="MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPE
FT                   KPAKAHKPSLEEVLQWRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIK
FT                   SPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALME
FT                   KDSLPRFVRSEFYKELIK"
FT   misc_difference 835^836
FT                   /gene="Rgs5"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 1290
FT                   /gene="Rgs5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1528
FT                   /gene="Rgs5"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1798..1812
FT                   /gene="Rgs5"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1812 BP; 534 A; 381 C; 376 G; 521 T; 0 other;
     ccacgcgtcc ggtcagctgt tgagaggttc gtgctcaagt tgaggatcta agccgccagc        60
     caaaatgtgt aagggactgg cagctctgcc gcactcatgc ctggaaaggg ccaaggagat       120
     caagatcaag ttgggaattc tcctccagaa gccagactct gctgttgacc ttgtcattcc       180
     atacaatgag aagccagaga agcctgccaa ggcacacaag ccctcactgg aggaggtcct       240
     gcagtggcgc cagtccctgg acaagcttct ccagaacagc tatggatttg ccagcttcaa       300
     aagtttcctg aagtctgaat tcagtgagga aaaccttgag ttctgggttg cctgtgagaa       360
     ttacaagaag atcaagtccc ccatcaaaat ggcggagaag gcaaagcaaa tttatgaaga       420
     attcatccag acagaggccc ctaaagaggt gaacattgac cacttcacta aagacatcac       480
     catgaagaac ctggtggaac cgtctcctcg cagctttgac ttggcccaga aaaggatcta       540
     tgccctgatg gagaaggatt ctctgccccg ctttgtgcgc tctgaatttt ataaggagct       600
     aatcaagtag tcatctggtc aggcttccaa aagttgccct gtgagttgag ttacatcctt       660
     tgtagcaaca cagcatcctc ccaggcacct gcacagttct ccatagcagc tttgctccaa       720
     gatacacaaa cataggcaaa ccacaggctg tgttgctaac tctttcgctc atgttagttt       780
     ggttatgtgg atctgttgtc taagagccct cacttttttc tttttctttt tttttctttt       840
     ttttggttct ttctgactgc tttgtaataa agatttacca agtcattgtc agtctaagtc       900
     acaaaaatat ccagtttaac ataaagctgt ctgtgcaaag aataggtgat agactgctat       960
     tttaaccagg ctgaaaagaa aaacagatgc aagtgtcccc tttcatgggg atttgactgg      1020
     tcttgtttat tgttttaatt cttattctct aatggcttca gaatttggtt agtaaaatag      1080
     cagcaagctg gtcataaggc agccaccgtt gggtttttca gcaaatgcat tatttaacac      1140
     tactgatctc tcctttctag agtaccgctg tgttatctgg acattctcaa taagagatac      1200
     aatgaataca ttgtgcttct aaacaggatt catttcaatc ctgcccttca tgtttccaaa      1260
     tctcgagggg aaaatggcag cctttgactc tctcgaacaa ttagaaatgc taatgcccag      1320
     acattttttg agctgtttct taaacaatgg aaacaataat ttaaaattaa tattttcttc      1380
     acattagttg gaatagccga atgtctgaaa atacccaagg agtgaaccgg ctgttacaca      1440
     ctcactcaga tgcctcctgt cattgtaacc tcaattgact ctgctcacaa attgtgtgat      1500
     tggttagtct tgtcagtgca gggtgaggag ggtaggaagg gtgcctcaag ggcagtgctg      1560
     tgaggccaca aaaggatgca ggcaggcatg cttctgcagt ctaagggctg cattatatat      1620
     ccagatattt actgtatcac tatataattt taaatttaga gcaatatata tacatacaca      1680
     cacacatata tatacatata tatttttcta atatataaaa tactcaatgg gcgataagta      1740
     gtctagttcc aaaggaaaag ccaaatgtat taaaattgga ctagaaacta tttgtagaaa      1800
     aaaaaaaaaa aa                                                          1812
//


spacer
spacer