Dbfetch

ID   BC037596; SV 2; linear; mRNA; STD; MUS; 731 BP.
XX
AC   BC037596;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   20-JAN-2018 (Rel. 135, Last updated, Version 13)
XX
DE   Mus musculus FK506 binding protein 11, mRNA (cDNA clone MGC:46745
DE   IMAGE:5250344), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-731
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-731
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-SEP-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-731
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-JAN-2018) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c95dd163e8079e8dfd9369a8db84e078.
DR   Ensembl-Gn; ENSMUSG00000003355; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022308; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022266; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022241; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022273; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022041; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022718; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021564; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022116; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022208; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022136; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022733; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021305; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021614; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003445; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042481; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042441; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042406; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042435; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042169; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042920; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042267; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042080; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042235; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042304; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042178; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042961; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041853; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041563; mus_musculus_wsbeij.
XX
CC   On Jan 18, 2018 this sequence version replaced BC037596.1.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 81 Row: l Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 15277330.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..731
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:46745 IMAGE:5250344"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..731
FT                   /gene="Fkbp11"
FT   CDS             46..651
FT                   /codon_start=1
FT                   /gene="Fkbp11"
FT                   /product="FK506 binding protein 11"
FT                   /db_xref="GOA:Q9D1M7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="MGI:MGI:1913370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1M7"
FT                   /protein_id="AAH37596.1"
FT                   /translation="MTLSPLLLPLQLLLLLLFSGAVCRAEAGPETESPVRTLQVETLVQ
FT                   PPESCTESAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMC
FT                   VGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIALIRANYWQKLLKSILPLVGIA
FT                   MVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKSKKK"
XX
SQ   Sequence 731 BP; 229 A; 175 C; 184 G; 143 T; 0 other;
     cgaacagcct gccctggtat cctggtgctc tgacccggtc caatcatgac cctgagccct        60
     ttgctcctac cactccagct gttactgctg ctactgttca gtggggcggt gtgccgggct       120
     gaggctgggc cagaaaccga aagtcctgtc cggaccctcc aagtggagac cctggtgcag       180
     ccccctgaat cgtgcacgga atctgctgcc attggagaca cgctccacat acactacacg       240
     ggcagtttgg tagatggacg cattattgac acttctctga ccagagatcc tctggtcata       300
     gaactcggcc aaaagcaggt gattccaggt ctggagcaga gccttttgga catgtgtgtg       360
     ggagagaagc gaagggcagt cattccttct cacctggctt atggaaagcg agggtacccg       420
     ccatctatcc cagccgatgc agtggtgcag tacgatgtgg agctgatcgc tttgattcga       480
     gccaactact ggcagaagct gctaaagagc attttgcctc tggtaggcat cgccatggtg       540
     ccggcgctcc tgggactgat cgggtatcac ctgtacagaa aggccagcag acccaaagtc       600
     tccaaaaaga agctaaaaga ggagaaacga aacaagagta agaagaaata aatagtggtt       660
     tttaacaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       720
     aaaaaaaaaa a                                                            731
//