Dbfetch

ID   BC037596; SV 1; linear; mRNA; STD; MUS; 755 BP.
XX
AC   BC037596;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus FK506 binding protein 11, mRNA (cDNA clone MGC:46745
DE   IMAGE:5250344), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-755
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-755
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-SEP-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9f6a2516baecec72b87eb2af5666e35a.
DR   Ensembl-Gn; ENSMUSG00000003355; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022308; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022266; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022241; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022273; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022041; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022718; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021564; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022116; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022208; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022136; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022733; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021305; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021614; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003445; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042481; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042441; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042406; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042435; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042169; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042920; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042267; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042080; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042235; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042304; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042178; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042961; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041853; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041563; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 81 Row: l Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 15277330.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..755
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:46745 IMAGE:5250344"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..755
FT                   /gene="Fkbp11"
FT   misc_difference 1..23
FT                   /gene="Fkbp11"
FT                   /note="23 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             70..675
FT                   /codon_start=1
FT                   /gene="Fkbp11"
FT                   /product="FK506 binding protein 11"
FT                   /db_xref="GOA:Q9D1M7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="MGI:MGI:1913370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1M7"
FT                   /protein_id="AAH37596.1"
FT                   /translation="MTLSPLLLPLQLLLLLLFSGAVCRAEAGPETESPVRTLQVETLVQ
FT                   PPESCTESAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMC
FT                   VGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIALIRANYWQKLLKSILPLVGIA
FT                   MVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKSKKK"
FT   misc_difference 399
FT                   /gene="Fkbp11"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 579
FT                   /gene="Fkbp11"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 693..755
FT                   /gene="Fkbp11"
FT                   /note="polyA tail: 63 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 755 BP; 231 A; 189 C; 190 G; 145 T; 0 other;
     ccacgcgtcc gcccacgcgt ccgccgaaca gcctgccctg gtatcctggt gctctgaccc        60
     ggtccaatca tgaccctgag ccctttgctc ctaccactcc agctgttact gctgctactg       120
     ttcagtgggg cggtgtgccg ggctgaggct gggccagaaa ccgaaagtcc tgtccggacc       180
     ctccaagtgg agaccctggt gcagccccct gaatcgtgca cggaatctgc tgccattgga       240
     gacacgctcc acatacacta cacgggcagt ttggtagatg gacgcattat tgacacttct       300
     ctgaccagag atcctctggt catagaactc ggccaaaagc aggtgattcc aggtctggag       360
     cagagccttt tggacatgtg tgtgggagag aagcgaaggg cagtcattcc ttctcacctg       420
     gcttatggaa agcgagggta cccgccatct atcccagccg atgcagtggt gcagtacgat       480
     gtggagctga tcgctttgat tcgagccaac tactggcaga agctgctaaa gagcattttg       540
     cctctggtag gcatcgccat ggtgccggcg ctcctgggac tgatcgggta tcacctgtac       600
     agaaaggcca gcagacccaa agtctccaaa aagaagctaa aagaggagaa acgaaacaag       660
     agtaagaaga aataaatagt ggtttttaac aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       720
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa                                  755
//