spacer

EBI Dbfetch

ID   BC037012; SV 1; linear; mRNA; STD; MUS; 4384 BP.
XX
AC   BC037012;
XX
DT   29-AUG-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus protein kinase D3, mRNA (cDNA clone MGC:47171 IMAGE:5342428),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4384
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4384
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (23-AUG-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 58c0f0adf6637d8d8663a14f319dc9dc.
DR   Ensembl-Gn; ENSMUSG00000024070; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168887; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 81 Row: m Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 27753988.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4384
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:47171 IMAGE:5342428"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4384
FT                   /gene="Prkd3"
FT                   /note="synonym: PKD3"
FT   misc_difference 1..11
FT                   /gene="Prkd3"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 35
FT                   /gene="Prkd3"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 70
FT                   /gene="Prkd3"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   CDS             407..3076
FT                   /codon_start=1
FT                   /gene="Prkd3"
FT                   /product="protein kinase D3"
FT                   /db_xref="GOA:Q8K1Y2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015727"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="MGI:MGI:1922542"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K1Y2"
FT                   /protein_id="AAH37012.1"
FT                   /translation="MSANNSPPSAQKSVFPATVSAVLPAPSPCSSPKTGLSARLSNGSF
FT                   SAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFG
FT                   MYDKILLFRHDMNSENILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYK
FT                   APTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGL
FT                   SVPRPLQPECVPLLSEESHTHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGR
FT                   PTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPCSVGTDADM
FT                   PMDIDSSDVNSDGSRGLDDSEEPSPPEDKMFFLDPTDLDVERDEETVKTISPSTSNNIP
FT                   LMRVVQSIKHTKRRSSTVVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYK
FT                   EIPLSEILRVSSPQDFTSISQGSNPHCFEIITDTVVYFVGENNGSSSHNPVLAATGVGL
FT                   DVAQSWEKAIRQALMPVTPQASVCTSPGQGKDHNLATSISVSNCQVQENVDISSVYQIF
FT                   ADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIV
FT                   NLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNI
FT                   VHCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYN
FT                   RSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAAFMYPPNPWREISSEAIDLINNLL
FT                   QVKMRKRYSVDKSLSHPWLQDYQTWLDLREFETRIGERYITHESDDARWEIHAYTHNLE
FT                   YPKHFIMAPNPDDMEEDP"
FT   misc_difference 1105
FT                   /gene="Prkd3"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1399
FT                   /gene="Prkd3"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1462
FT                   /gene="Prkd3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2773
FT                   /gene="Prkd3"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2863
FT                   /gene="Prkd3"
FT                   /note="'T' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3107
FT                   /gene="Prkd3"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3148
FT                   /gene="Prkd3"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3593
FT                   /gene="Prkd3"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 4117
FT                   /gene="Prkd3"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
XX
SQ   Sequence 4384 BP; 1241 A; 974 C; 992 G; 1177 T; 0 other;
     ccacgcgtcc gtcttgatac agatcaacta ttctatttgt ttttctgaaa tgaaaagcaa        60
     aagacaagaa cagatttaga agaagtgaag atgtcttgta aatattcagc atgaactctg       120
     ttcttccgac gatgatggtg atgtgaagtg ggggacagat ctgggtgtgg tcctaaagac       180
     aagattcttg atgggactga taccgacagc aataggatct tttgagtatt caactcggag       240
     taacagaatt tgtcatcaac ggcatgaatg gctcagccga ggaaatagag cagctttcat       300
     ctaaatccaa gcgtgtcgtc attttttcac tgctattatt ttgaaaactt cttcaaaacc       360
     atttaaaaag cattgacaac taattttata gatcaaagaa aggcagatgt ctgcaaataa       420
     ttcccctcca tcagcccaga aatctgtgtt ccctgcaact gtttctgctg tgcttccagc       480
     tccttctccg tgttcaagtc ccaaaacagg actctcagct cggctctcta atggcagctt       540
     cagtgccccg tcactcacaa actctagagg ctcagtgcac acagtttcat ttctacttca       600
     gattggcctc acacgagaga gtgttaccat cgaggcccag gaactgtctc tctctgctgt       660
     caaagacctc gtgtgctcca ttgtttatca gaagtttcca gagtgtggat tctttggcat       720
     gtatgataaa attcttctct ttcgccacga catgaactca gaaaacattt tgcagctgat       780
     tacctcagca gatgaaatac atgaagggga cctggtagaa gttgtcctgt cagctttggc       840
     cacagtggaa gacttccaga tccgccctca cgctctctat gtacattctt acaaagcacc       900
     tactttttgt gattactgtg gtgaaatgct ctggggactg gtacgtcaag gattaaaatg       960
     tgaaggctgt ggattaaatt atcataaacg atgtgccttc aagattccaa ataactgcag      1020
     tggagtaaga aagagacgtc tgtcaaatgt atctctgcca ggacctggcc tctcagttcc      1080
     aagacccctg cagcctgagt gtgtccccct tctcagtgaa gagtcacata ctcaccaaga      1140
     gcccagtaag agaatcccgt cgtggagtgg tcgtccgatc tggatggaaa agatggtaat      1200
     gtgcagggtc aaagtccctc acacatttgc tgtccactct tatggccgcc cgaccatatg      1260
     ccagtactgc aagcgcctgc tgaaaggcct cttccgccaa gggatgcagt gtaaagattg      1320
     caaattcaac tgccataaac gctgtgcatc caaagtacca agagactgcc ttggcgaagt      1380
     tactttcaat ggagagccct gcagcgtggg gactgatgca gacatgccca tggatattga      1440
     cagtagtgat gtgaacagtg acggcagtag gggcttggat gactcagagg agccgtcccc      1500
     gcccgaagac aagatgttct tcctcgaccc gactgatctc gacgtggagc gagatgagga      1560
     gactgttaag acaatcagtc catccaccag caataatatc ccgctgatga gggtggtgca      1620
     gtccatcaag cacacaaaga ggaggagcag cacagttgtg aaggaagggt ggatggtcca      1680
     ctacaccagc agggacaacc tgagaaagag acattattgg agacttgaca gtaaatgtct      1740
     aacattgttt caaaatgaat ctggatcaaa gtattataag gaaattccac tttcagaaat      1800
     tctccgtgta tcttcaccgc aagatttcac cagcatttca caaggcagta acccacactg      1860
     ttttgaaatc atcaccgata ccgtggtata ctttgttggt gagaacaatg ggagcagctc      1920
     tcataatcct gttctcgctg ccactggagt gggactagat gtggcgcaga gctgggaaaa      1980
     agcaattcgc caggccctca tgcctgtcac tcctcaagca agtgtttgca cttctccggg      2040
     gcaagggaag gaccacaatc tggctaccag tatctccgtg tctaactgtc aggttcagga      2100
     gaatgtcgac atcagcagcg tttaccagat ctttgcggac gaggtgcttg gttctggcca      2160
     gtttggcatt gtttatggag gaaaacacag aaagacggga agggatgtgg ctattaaagt      2220
     gattgataaa atgaggttcc ccacaaagca agagagtcag ctccggaacg aagtggccat      2280
     tttacagaat ctgcaccatc ctgggattgt aaacctggag tgtatgtttg aaaccccaga      2340
     acgagtcttc gtggtgatgg aaaagctcca tggagatatg ttggaaatga ttctgtccag      2400
     tgaaaagagt cgacttccag aacggattac caaattcatg gtcacacaga tacttgttgc      2460
     cttgaggaat ttacatttca agaatattgt gcactgtgat ttaaagcccg aaaatgtgct      2520
     gcttgcatcc gcagagccat ttcctcaggt gaagctgtgt gactttgggt ttgcccgcat      2580
     cattggtgag aagtcgttcc ggaggtcagt ggtaggaact ccagcctact tagcccctga      2640
     ggttctcagg agcaaaggct acaaccgttc tctagacatg tggtcggtgg gcgtcatcgt      2700
     ttatgtgagc ctcagtggca cattcccatt caatgaagat gaagatataa atgaccaaat      2760
     ccaaaacgct gcatttatgt acccaccaaa tccatggcga gaaatttcca gtgaagcaat      2820
     tgacttgata aacaacttgc ttcaagtgaa gatgagaaaa cgttacagtg ttgacaaatc      2880
     tctcagtcat ccttggctac aggattatca gacttggctt gacctcagag aatttgaaac      2940
     tcgcattgga gaacgttaca ttacacacga aagtgatgat gctcgctggg aaatacacgc      3000
     atacacgcac aatctggaat acccaaagca tttcattatg gcccccaacc cagacgacat      3060
     ggaggaggat ccttagttgt cagtgcgccg acctcaataa ggaagggttt cacttcaaga      3120
     gcggatactt tgctgcatgg ctggtggtct ctgcaggcta ccattgcaag gcggcagcac      3180
     cgtgaggaag tagaaggact tgtggcatca gttctgtagc tcataacgag taggtacatg      3240
     aagggaaact gagtaataaa gtcaaaatgg aacttctata aatttttata gcataagcaa      3300
     taactggttc tgtaattttt cctaatcctt cacattagca caatgtgagt tagcacttaa      3360
     tttatctctt ttacctctcc ttttctgtta ttacatcatt tgttttaaag gcctatgact      3420
     gtctagttat tgcttataag gttgattact caacaggttt gcagttaagc agtaaccatg      3480
     aggctaacag catacagctt gctgtaagga cctttagtgt ttgtccactg tcggaggcat      3540
     tgcttcctcc ttcctggacc cgataagcag accattgtac tgctggcctt ccagtggatg      3600
     cgtctttcca tatggcctgt atgacagaag agttgtcaca ttttccatgt tataacagtc      3660
     actaggataa tcgaacaatt ggtgttacaa atgaatagaa atagctggtc atcactcagc      3720
     tctgcctctg aacacgtatg ttctcaattg gcaccatcat gttacagtat gccacagtcg      3780
     gtgggcacaa cgctgcattt aactaattta tcctcacctg gagttgaata atgtatagac      3840
     aaaatcacat actagagagg gaagctaaca caggtcagta gatgtcactg ttatctgttt      3900
     cctcttccct tggcctttgg atggggtttc caatacctag tgtttttaaa ttagcattgt      3960
     cgtttgagca gtttggagga gtgactgaag tcaaacatga aaacttagtt tattgaggtg      4020
     ggacctaatt accagtagag cggatggaga aggagtaaga acgtcttaca cttcagctcc      4080
     aacagccagc tgttttgtag tagttattaa tacaagctca gtatccctat ctgagctgct      4140
     ctacaccagg aaggtttcac tgccagatac tgaaatgttt gcacactcta ctagttgagc      4200
     atccctgacc tacaaatccg aaatcctcca aattcaagaa actttggagt ccttcagatt      4260
     tccacattag tgatattccc acctgtgctt tacccaaaga gaaaaagatc caggaccatc      4320
     ctctcacaag aaatatagta gctgtttgtt tcttcattcc tcactagtca caaaaaaaaa      4380
     aaaa                                                                   4384
//


spacer
spacer