spacer

EBI Dbfetch

ID   BC035993; SV 1; linear; mRNA; STD; HUM; 1385 BP.
XX
AC   BC035993;
XX
DT   01-NOV-2002 (Rel. 73, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens annexin A1, mRNA (cDNA clone MGC:32774 IMAGE:4662939),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1385
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1385
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a682a584da172e40449b2c5363226dc9.
DR   Ensembl-Gn; ENSG00000135046; homo_sapiens.
DR   Ensembl-Tr; ENST00000257497; homo_sapiens.
DR   Ensembl-Tr; ENST00000376911; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: CLONTECH
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 41 Row: h Column: 9.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1385
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_77"
FT                   /clone="MGC:32774 IMAGE:4662939"
FT                   /tissue_type="Lung"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:9606"
FT   gene            1..1385
FT                   /gene="ANXA1"
FT   CDS             75..1115
FT                   /codon_start=1
FT                   /gene="ANXA1"
FT                   /product="annexin A1"
FT                   /db_xref="GOA:P04083"
FT                   /db_xref="H-InvDB:HIT000051574.15"
FT                   /db_xref="HGNC:HGNC:533"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002388"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="PDB:1AIN"
FT                   /db_xref="PDB:1BO9"
FT                   /db_xref="PDB:1QLS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04083"
FT                   /protein_id="AAH35993.1"
FT                   /translation="MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPS
FT                   SDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHL
FT                   EEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRD
FT                   LAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFN
FT                   TILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEK
FT                   LHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILV
FT                   ALCGGN"
FT   misc_difference 401
FT                   /gene="ANXA1"
FT                   /note="'G' in cDNA is 'A' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
FT   misc_difference 1357..1385
FT                   /gene="ANXA1"
FT                   /note="polyA tail: 29 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1385 BP; 473 A; 267 C; 291 G; 354 T; 0 other;
     agtgtgaaat cttcagagaa gaatttctct ttagttcttt gcaagaaggt agagataaag        60
     acactttttc aaaaatggca atggtatcag aattcctcaa gcaggcctgg tttattgaaa       120
     atgaagagca ggaatatgtt caaactgtga agtcatccaa aggtggtccc ggatcagcgg       180
     tgagccccta tcctaccttc aatccatcct cggatgtcgc tgccttgcat aaggccataa       240
     tggttaaagg tgtggatgaa gcaaccatca ttgacattct aactaagcga aacaatgcac       300
     agcgtcaaca gatcaaagca gcatatctcc aggaaacagg aaagcccctg gatgaaacac       360
     tgaagaaagc ccttacaggt caccttgagg aggttgtttt ggctctgcta aaaactccag       420
     cgcaatttga tgctgatgaa cttcgtgctg ccatgaaggg ccttggaact gatgaagata       480
     ctctaattga gattttggca tcaagaacta acaaagaaat cagagacatt aacagggtct       540
     acagagagga actgaagaga gatctggcca aagacataac ctcagacaca tctggagatt       600
     ttcggaacgc tttgctttct cttgctaagg gtgaccgatc tgaggacttt ggtgtgaatg       660
     aagacttggc tgattcagat gccagggcct tgtatgaagc aggagaaagg agaaagggga       720
     cagacgtaaa cgtgttcaat accatcctta ccaccagaag ctatccacaa cttcgcagag       780
     tgtttcagaa atacaccaag tacagtaagc atgacatgaa caaagttctg gacctggagt       840
     tgaaaggtga cattgagaaa tgcctcacag ctatcgtgaa gtgcgccaca agcaaaccag       900
     ctttctttgc agagaagctt catcaagcca tgaaaggtgt tggaactcgc cataaggcat       960
     tgatcaggat tatggtttcc cgttctgaaa ttgacatgaa tgatatcaaa gcattctatc      1020
     agaagatgta tggtatctcc ctttgccaag ccatcctgga tgaaaccaaa ggagattatg      1080
     agaaaatcct ggtggctctt tgtggaggaa actaaacatt cccttgatgg tctcaagcta      1140
     tgatcagaag actttaatta tatattttca tcctataagc ttaaatagga aagtttcttc      1200
     aacaggatta cagtgtagct acctacatgc tgaaaaatat agcctttaaa tcatttttat      1260
     attataactc tgtataatag agataagtcc attttttaaa aatgttttcc ccaaaccata      1320
     aaaccctata caagttgttc tagtaacaat acatgaaaaa aaaaaaaaaa aaaaaaaaaa      1380
     aaaaa                                                                  1385
//


spacer
spacer