Dbfetch

ID   BC035949; SV 1; linear; mRNA; STD; MUS; 1491 BP.
XX
AC   BC035949;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   27-MAY-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Mus musculus leucine-rich repeat kinase 2, mRNA (cDNA clone IMAGE:4242403),
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1491
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1491
RA   Director MGC Project;
RT   ;
RL   Submitted (31-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 1069e24a5dcfeaafb1b05361877461b8.
DR   Ensembl-Gn; ENSMUSG00000036273; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060642; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 43 Row: o Column: 23.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1491
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="IMAGE:4242403"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1491
FT                   /gene="Lrrk2"
FT                   /note="synonym: cI-46"
FT   CDS             <1..985
FT                   /codon_start=2
FT                   /gene="Lrrk2"
FT                   /product="Lrrk2 protein"
FT                   /db_xref="GOA:Q5S006"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020859"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032171"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1913975"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5S006"
FT                   /protein_id="AAH35949.1"
FT                   /translation="CLALVHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEKMTDSV
FT                   TCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLS
FT                   ESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKTNQLFSYAAFSDSNIIALAVDTAL
FT                   YIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKLNKESKHQLSYSGRVKALCLQKN
FT                   TALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTE
FT                   GIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRKTSVE"
FT   misc_difference 910
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 992
FT                   /gene="Lrrk2"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1049
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1061
FT                   /gene="Lrrk2"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1158
FT                   /gene="Lrrk2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1187
FT                   /gene="Lrrk2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1225
FT                   /gene="Lrrk2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1292
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1382
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1479..1491
FT                   /gene="Lrrk2"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1491 BP; 493 A; 268 C; 307 G; 423 T; 0 other;
     gtgcttggct ttggtgcatc tcgctgctga gaaagagagc tgggttgtgt gcgggacaca        60
     gtctggggct ctcctggtca tcaatgttga agaggagaca aagagacaca ccctggaaaa       120
     gatgactgat tctgtcactt gtttgcattg caattccctt gccaagcaga gcaagcaaag       180
     taactttctt ttggtgggaa ctgctgatgg taacttaatg atatttgaag ataaagccgt       240
     taagtgtaaa ggagctgccc ccttgaagac actacacata ggcgatgtca gtacgcccct       300
     gatgtgcctg agcgagtccc tgaattcatc tgaaagacac atcacatggg gagggtgtgg       360
     cacaaaggtc ttctcctttt ccaatgattt caccattcag aaactcatcg agacaaaaac       420
     caaccagctg ttttcttacg cagctttcag cgattctaac atcatagcgc tggcagtaga       480
     cacagccctg tatattgcca agaaaaacag ccctgtcgta gaggtgtggg acaagaaaac       540
     agaaaagctc tgtgaattaa tagactgtgt gcacttctta aaggaggtga tggtaaaact       600
     aaacaaggaa tcgaaacatc agctgtccta ctctgggagg gtgaaggccc tctgcctgca       660
     gaagaacacg gctctctgga tcggaactgg aggaggccac atcttactcc tggatctttc       720
     tactcggcga gttatccgca ccattcacaa tttctgtgat tctgtgagag ccatggccac       780
     agcacaatta ggaagcctta agaatgtcat gctggttttg gggtacaagc ggaagagtac       840
     agagggtatc caagaacaaa aagagataca atcttgtttg tctatttggg acctcaatct       900
     tccacacgaa gtgcaaaatt tagaaaaaca cattgaagta agaacagaat tagctgataa       960
     aatgaggaaa acatctgttg aatagaaaga cgtcaggcag tctcgatgtt atattgaata      1020
     agacatcaga catcctcgtc actatattaa aaaggacatc ggacatcctc gccaatatgt      1080
     tagaaaatgt actcttcttt ttaaaatata tttttaaaat gtttacattg aaaagagtat      1140
     gcctattctt tacaaagctc atatgtatat gaaggaatgt gtatgtttta tgtttaattt      1200
     aatatatgta aaaatattta tcagcaaata tgttttaaaa aactatttaa tttagcatta      1260
     tattttctat actccttaac taatttgaag gaataaacaa aagaaatcta caaagcattt      1320
     aatttcagta tttatactaa aattaataaa aatatcatgt ttgttttgct atgtattgtg      1380
     aagataaagc ctattttaaa ttgttgatta agacacagat gttgcttgat tatctatgga      1440
     ctcagcggag tagaataaaa tatctggtca atttccaaaa aaaaaaaaaa a               1491
//