spacer

EBI Dbfetch

ID   BC035272; SV 1; linear; mRNA; STD; MUS; 3512 BP.
XX
AC   BC035272;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus cyclic nucleotide gated channel alpha 3, mRNA (cDNA clone
DE   MGC:38684 IMAGE:5357087), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3512
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3512
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; fd4cea07b6b19998e1ffb2b4d6f73f16.
DR   Ensembl-Gn; ENSMUSG00000026114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027288; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 54 Row: e Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 33859523.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3512
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:38684 IMAGE:5357087"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3512
FT                   /gene="Cnga3"
FT                   /note="synonym: CNG3"
FT   CDS             315..2210
FT                   /codon_start=1
FT                   /gene="Cnga3"
FT                   /product="cyclic nucleotide gated channel alpha 3"
FT                   /db_xref="GOA:Q9JJZ8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="MGI:MGI:1341818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJZ8"
FT                   /protein_id="AAH35272.1"
FT                   /translation="MAKVNTQCSQPSPTQLSIKNADRDLDHVENGLGRVSRLIISIRAW
FT                   ASRHLHDEDQTPDSFLDRFHGSELKEVSTRESNAQPNPGEQKPPDGGEGRKEEPIVVDP
FT                   SSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRA
FT                   RTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKLGVNYPELRFNRLLKF
FT                   SRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNT
FT                   SKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNV
FT                   GSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLK
FT                   NLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGR
FT                   EMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDL
FT                   FCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLIDEDLVAARVDTRDVEEKVEYLES
FT                   SLDILQTRFARLLAEYSASQMKLKQRLTRLESQMNRRCCGFSPDRENSEDASKTD"
FT   misc_difference 3499..3512
FT                   /gene="Cnga3"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3512 BP; 854 A; 868 C; 916 G; 874 T; 0 other;
     cctcaggctg ccaatctact ggctactctg ggctgggact gtggagctag gaagtgggaa        60
     aagctgatcc aggttttgtt ttgttttgtt ttgttttgtt ttgttttgtt ttgttttgtt       120
     tttctcatca tctccctctc tgatgctgtt gggactttga tcttcagaag caagcgtctt       180
     cctaggcacg gcttgcctcc ttcaagaagg agacttaagc agagcggtgt ggagtctgca       240
     gccttcgata agcaggcatt ggtgaaacag cctcacagca ggccaccccg gggctgaatg       300
     tgacctgtgc agagatggca aaggtgaaca cccagtgttc acagccctcc ccgacccaac       360
     tttcaataaa gaatgcggac agagatctcg accacgtaga gaacggcctg ggcagggtgt       420
     cacgcctcat catctcgatt cgtgcgtggg cctccaggca cttacacgat gaagaccaga       480
     cacctgactc ctttttggat cgatttcatg gatctgagct taaggaagtc tccacccggg       540
     aaagcaatgc ccagcccaac ccaggagaac agaagccacc agacggaggg gaaggcagga       600
     aggaggagcc cattgtggtg gacccctcca gcaacatcta ctaccgctgg ctgactgcca       660
     tcgcgctccc agtcttctat aactggtgtc tacttgtatg cagggcctgt tttgatgagc       720
     tacaatcaga gcacctgacg ctgtggctgg tcttggacta ctctgcagat gtcctttatg       780
     ttttagacat gctggttcga gcccggacag gtttccttga gcaaggccta atggtcagag       840
     ataccaagag gctgtggaaa cattacacaa agaccttgca cttcaagctg gacatcctgt       900
     ctctcatccc cacagacctg gcttatttaa agttgggcgt gaactaccca gaactgaggt       960
     tcaaccgcct cctgaagttc tctcggctct ttgaattctt tgaccgcaca gagacaagga      1020
     ccaactaccc caacgtgttc aggataggga acttggtcct ttacacactc atcatcatcc      1080
     actggaatgc ctgcatctac tttgccattt ccaagttcat tggttttggg acagactcct      1140
     gggtctatcc aaacacctcc aagccggagt atgcacgact ctcccggaag tacatttaca      1200
     gtctctactg gtccaccctg accctgacca ccattggtga gaccccaccc cccgtgaaag      1260
     atgaagagta tctctttgtg gtcatcgact tcctggtggg tatcctgatc tttgccacca      1320
     tagtgggcaa cgtaggctcc atgatttcca acatgaacgc tccccgggta gagttccagg      1380
     ctaagatcga ctccgtcaag cagtacatgc agttccggaa ggtaaccaag gacttggaga      1440
     ctcgggttat ccggtggttt gactatctgt gggccaacag gaagacggtg gatgaaaagg      1500
     aagtgctcaa aaacctcccg gacaagctga aggctgagat cgccatcaac gtgcacctgg      1560
     acacgctgaa gaaggtccga atcttccagg actgcgaggc ggggctgctg gtggagctgg      1620
     tgctgaagct ccgccccact gtgttcagcc ccggggacta catatgcaaa aagggggaca      1680
     ttggaagaga gatgtacatc atcaaggagg gcaagctggc tgtggtggct gatgacgggg      1740
     tcacccagtt tgtggtcctc agtgacggca gttactttgg ggagattagc atcttaaaca      1800
     ttaaggggag caagtctggg aaccgcagga cggccaacat caggagtatc ggctactcag      1860
     acctgttctg cctctccaag gatgacctaa tggaagccct caccgagtac ccagacgcta      1920
     agagggctct ggaggaaaag ggccgtcaga ttctgatgaa ggacaaccta attgatgagg      1980
     acctagtcgc ggccagggta gataccaggg acgttgagga gaaggtggag tacctggagt      2040
     cgtccctgga catcctgcag acgaggtttg cccgactcct ggctgagtac agtgcctccc      2100
     agatgaagct gaaacagcgg ctcactcggc tggagagcca gatgaacagg aggtgttgtg      2160
     gcttctcacc tgacagggag aattccgagg atgcttcaaa gactgactga aaatgcaggt      2220
     ggctctgcct cctgctcccc cccccccccc ccggggccag ctctctgggc gacactatat      2280
     agcctcgggg taaagggttt ggctgtggtt tcgcctcagt gctactcatc ctttgggagt      2340
     ggtgtgacag caaggaagag ccttagtttc ctctcctatg aaatgggact catggctgtc      2400
     ggccccagaa gttccagact atcatgaggt ggcgaaggtt gtggctttgg aaagcgtgaa      2460
     gagttcccaa cccagtgtat aagcatatgt gcacatgatt ctaatgttgt tagttatgtt      2520
     ggcatatggg tatgttcagt tgtcggcgga ggtcaggaga gggcgttgca tcccctgggc      2580
     tggagttacc tgctgttgta agctacccag catgggtgct gggatcctgt cttcattagg      2640
     gttactattg ctgtgatgaa atatcataac caatgcaagt taggaagaaa aggttttttt      2700
     ttcggcttac actccacatc atagtccatc attgaaggaa gtcagggcag gaactcaaac      2760
     tgggcaggaa gctggaggca ggagctgatg cagaggccat aaaggggagc tgcttactgg      2820
     tttgctcttc ttagcttgct aagcctgctt tcttatagaa cccagaacca ccagcccggg      2880
     agtagtccta cttgcaatgg gctaggccct ccttcatcta tcattagtta aggaaatgct      2940
     ccacggactt gcctacagct ggatcttagg gaggcatttt ctcagtcatc ctctcagatg      3000
     actctaactt gtgtcaagtt gacataaaaa tccgaccagc acaaatccaa acgtgtagtc      3060
     cttcccatat ttattgaggt gaaggtcctg ctctgttacc cagtccagcc ttcaactccc      3120
     atgcccaagt gttgtcccct cgccagcctt ccaagtagct gggaccacag gcacactcca      3180
     ctgtttccaa cccagataag ttttgttttg ttttgttttg ttttgttttg ttttgtttta      3240
     atgaaatcca tgggaatgtt taagcccctt atcctagcta tgttataaat ggatgtctta      3300
     cggggctggt gagataactc agtggttaag agcactagct gctcttccag aggtcatgag      3360
     ttcaattccc agcaaccaca aggtggctca caaccatcta tagggggatc tgatgccctc      3420
     ttcgggcagg tggatatatg tgcaaaagag cactcataca ttaaataata aatacaatta      3480
     aagatatata taaatggaaa aaaaaaaaaa aa                                    3512
//


spacer
spacer