Dbfetch

ID   BC035203; SV 1; linear; mRNA; STD; MUS; 4933 BP.
XX
AC   BC035203;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus phosphatidylinositol 3-kinase catalytic delta polypeptide,
DE   mRNA (cDNA clone MGC:28528 IMAGE:4192906), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4933
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4933
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1cfc5e3a1fb51f571dc2bab82a0672c7.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029144; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029109; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029057; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029125; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028846; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029574; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028808; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028957; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028921; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028948; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029606; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027979; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028339; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000038859; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069360; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0069424; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0069331; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069344; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069001; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069836; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069481; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068947; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0069085; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0069160; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069005; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070022; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068963; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068167; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 37 Row: f Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6679318.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4933
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:28528 IMAGE:4192906"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4933
FT                   /gene="Pik3cd"
FT                   /note="synonym: p110delta"
FT   misc_difference 126
FT                   /gene="Pik3cd"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   CDS             296..3433
FT                   /codon_start=1
FT                   /gene="Pik3cd"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide"
FT                   /db_xref="GOA:Q8CI98"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CI98"
FT                   /protein_id="AAH35203.2"
FT                   /translation="MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTI
FT                   KQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAR
FT                   EGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWL
FT                   QYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALR
FT                   KKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSS
FT                   ILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMK
FT                   LVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVE
FT                   KAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGT
FT                   VRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEEQLQLREILER
FT                   RGSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPV
FT                   LSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLG
FT                   RALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKA
FT                   LNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCSVEQCTFM
FT                   DSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMT
FT                   PYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDR
FT                   AIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRER
FT                   VPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPE
FT                   LSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ"
FT   misc_difference 598
FT                   /gene="Pik3cd"
FT                   /note="'G' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 640
FT                   /gene="Pik3cd"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1969
FT                   /gene="Pik3cd"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2962
FT                   /gene="Pik3cd"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3169
FT                   /gene="Pik3cd"
FT                   /note="'A' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3190
FT                   /gene="Pik3cd"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3268
FT                   /gene="Pik3cd"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3509
FT                   /gene="Pik3cd"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3851
FT                   /gene="Pik3cd"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 4417
FT                   /gene="Pik3cd"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 4427
FT                   /gene="Pik3cd"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 4533
FT                   /gene="Pik3cd"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 4645
FT                   /gene="Pik3cd"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 4649
FT                   /gene="Pik3cd"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 4776..4784
FT                   /gene="Pik3cd"
FT                   /note="9 bases in cDNA are not found in the mouse genome."
FT   misc_difference 4915..4933
FT                   /gene="Pik3cd"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4933 BP; 1110 A; 1405 C; 1398 G; 1020 T; 0 other;
     cctgttatct gtagaaagga aacaaagtgg gaagtggagt gtgcggactg tcagtaggcg        60
     ggctgtcccg ctgcgcgccc cgcctctggc tcactcgcgc ctagccttgg ggctgccagc       120
     tccgcggacc cagctgctgg accgacatct aaggagctga gagccaggca gaagtgggat       180
     gaagcccgct gatgccaaag tacctttaat ctcccaggca gaggggcctt ggctggtggt       240
     ccttcttggc ccataccaaa caggaaaaca gacctcagag aagtaacaca acaggatgcc       300
     ccctggggtg gactgcccca tggagttctg gaccaaagag gagagccaga gcgtggttgt       360
     tgacttcttg ctgcccacag gggtctactt gaacttcccc gtgtcccgca atgccaacct       420
     cagcaccatc aagcaggtgc tgtggcaccg tgcacagtat gagccactct tccacatgct       480
     cagtgacccc gaggcctatg tgttcacctg tgtgaaccag acggcggagc agcaggagtt       540
     ggaggatgag cagcggaggc tgtgcgacat ccagcccttc ctgcccgtgc tgcgcctggt       600
     ggcccgagag ggggaccgcg tgaagaagct cattaactct cagatcagcc tcctcattgg       660
     caaaggtctc catgagtttg attccctgcg ggacccggaa gtaaacgact tccgcactaa       720
     gatgcgccag ttttgtgaag aggctgctgc tcaccgccag cagctgggct gggtggaatg       780
     gctgcagtac agcttccccc tgcagctgga gccctcagca aggggttggc gggccggctt       840
     attgcgtgtc agcaaccgag ccctgctggt caacgtgaag ttcgagggca gtgaggagag       900
     cttcaccttc caggtatcca ccaaggacat gcccctggca ctgatggcct gtgccctccg       960
     aaaaaaggcc acagtgttcc ggcagcctct ggtggagcag cctgaggaat atgccctgca      1020
     ggtgaacggg aggcacgaat acctctacgg caactacccg ctctgccact ttcagtacat      1080
     ctgcagctgc ctacacagcg ggctgacccc tcatctgacc atggtccact cctcctccat      1140
     ccttgctatg cgggatgagc agagcaatcc tgccccccaa gtacagaaac cacgtgccaa      1200
     acctcccccg atccctgcca agaagccctc ctctgtgtcc ctgtggtccc tggaacagcc      1260
     attctccatt gagctgatcg agggccgaaa agtgaatgct gacgagcgga tgaagctggt      1320
     tgttcaggcc gggctcttcc atggcaatga gatgctgtgc aagactgtgt caagctcgga      1380
     ggtgaatgta tgctcagagc ccgtgtggaa gcagcgactg gagttcgata tcagcgtctg      1440
     tgacctcccg cgcatggctc gactctgttt tgctctctat gccgtcgtgg agaaggctaa      1500
     gaaggcacgc tccacaaaga agaagtctaa gaaggcggac tgccccatcg cttgggccaa      1560
     cctcatgcta ttcgactaca aagatcagct caagacgggg gagcgctgcc tctacatgtg      1620
     gccctctgtc ccagatgaga agggagagct gctgaatcct gcgggtacag tgcgcgggaa      1680
     ccccaacacg gagagtgccg ctgccctggt catctacctg cctgaggtgg ccccccaccc      1740
     tgtgtacttc cccgctctgg agaagatcct ggagctgggg cgtcacgggg agcgtgggcg      1800
     catcacggag gaggagcagc tgcagctgcg ggagatcctg gaacggcggg gatccgggga      1860
     actgtacgaa catgagaagg acctggtgtg gaagatgcgc cacgaagtcc aggagcattt      1920
     cccagaggcg ctggcccgcc tgctgctggt caccaagtgg aataaacatg aggatgtggc      1980
     ccagatgctc tatttgctgt gctcctggcc cgagctgcct gtgctgagcg ccctggaact      2040
     tctggacttt agctttcccg actgctacgt gggctccttc gccatcaagt cccttcggaa      2100
     gctgacggac gatgagctct tccagtacct tctgcagctg gtgcaagtgc tcaaatatga      2160
     gtcctacctg gactgcgagc tgaccaaatt cttgctgggc cgagccctgg ctaaccgcaa      2220
     gatcggacac ttcctgttct ggcacctccg ctctgagatg cacgtaccat cagtggctct      2280
     gcggtttggt ctcatcatgg aagcctactg cagaggcagc acccaccaca tgaaggtgct      2340
     gatgaagcag ggggaagcac tgagcaagct taaggcactg aatgactttg tgaaggtgag      2400
     ttcccagaag accaccaagc cccaaaccaa ggagatgatg catatgtgca tgcgccagga      2460
     gacctacatg gaggccctgt cccacctgca gtctccactc gaccccagca ccctgctgga      2520
     ggaagtctgc agtgtggagc agtgcacctt catggactcc aaaatgaagc ccctgtggat      2580
     catgtacagc agcgaggagg cgggcagtgc tggcaacgtg ggcatcatct ttaagaacgg      2640
     ggatgacctc cgccaggaca tgctgactct gcagatgatc cagctcatgg acgtcctgtg      2700
     gaagcaggag ggcctggacc tgaggatgac gccctacggc tgcctcccca ccggggaccg      2760
     cacaggtctc atcgaggtgg tcctccactc ggacaccatc gccaacatcc agctgaacaa      2820
     aagcaacatg gcggccacag ctgccttcaa caaggacgcc ctgctcaact ggctcaagtc      2880
     caagaaccct ggggaggccc tggatcgggc cattgaggaa ttcaccctct cctgtgctgg      2940
     ctactgtgtg gccacatatg tgctgggcat cggtgaccgg cacagcgaca acatcatgat      3000
     cagagagagt gggcagctct tccacattga ttttggccac tttctgggga acttcaagac      3060
     caagtttgga atcaaccgag agcgcgtccc cttcattctc acctacgact ttgtccacgt      3120
     gatccagcag gggaagacta acaacagtga gaagtttgaa aggttccgag gctactgtga      3180
     acgagcctac accatcctgc ggcgccacgg gctgcttttc ctccatctct tcgccctgat      3240
     gcgggccgca ggtctgcctg agcttagttg ctccaaagat atccagtatc tcaaggactc      3300
     tctggcactg gggaagacgg aggaagaggc gctaaagcac ttccgggtga agttcaacga      3360
     agctctccga gaaagctgga aaaccaaagt caactggctg gcgcacaatg tgtccaagga      3420
     taaccgacag taggaggcgc cccctggtgg tcatacggcg gttccctcct ggctttcagc      3480
     cctagaggta aaaggacagt cctggagagc aggcatgtcc agtggtcacc aaagggaccc      3540
     cagagcctga actgtccctc atggggaaga accacaccac tgcttcttgt ttacactggt      3600
     aatttattta tgactcgaaa tgtttaagga acagaatagc cataaatgga agtgcatttc      3660
     tgtgcagggg aggggtgatg tcctcatgat gtcatccccg gtcagcactg taacagcacc      3720
     ttgaggatcg aacccctagt cttccaacct gtgggtcttg gcccagcaag gacagttctt      3780
     ggggccttct tcccaggctc ccagcaggct gcctggaaca agcctggcgg tcacctggtg      3840
     cctccatcct tagctcacct ccggccaccg ttgtgtggcc tacccaacca agcctccggc      3900
     agctcttgag gaagccagga gcttccctct agactcaggc acacttgctc ggcactgctg      3960
     aagcgacctc ttgggtttgg gtacgggaac gccctcacct ctcatttgcg ggtaagaaca      4020
     cgatatgtag actctgtccc ttaccccgat ggctggggta agggacctgg cctccactac      4080
     agttagtgta ttccaggcct tgaagcactc agaccggtgc cccatttagc tccgtgtggt      4140
     cacgaatcaa gacgaagggc cagccagaat tgaagtcctc ttcgaagttc gtgtgagggg      4200
     cacacaaggc agctttatgg acggacagga ctgatctctt ccagagctga aatcgcagaa      4260
     ggcagctggg gagctaggct cgaaaagtgt gagcaaggac gagaacggaa ttcagtgtag      4320
     tctgggcagt cagaggaact cgagaaacgc agtctcggcc tcctcccagg gatccaaacg      4380
     ccagccaccc gcccggcttt tagagagccc agctcaaggg tcgcacgtgc ttatcgtccc      4440
     accccaagca catctccatg tatcagctgc cacctcagga cctggatctc ccggtagcat      4500
     tctgagactt tgagaaccat caccgctgtc tctccagcag cccagaacat ggctcaagga      4560
     gccccttcat gttgatgagc ccagggtcca gcagtgagcg gtggtgcctc cgcagcaccc      4620
     gctgaacccc tagtctgccc caccgacttt gaaataggaa acgtgtctgt gtgtgtgtat      4680
     gtatgtatgc catgttattt attgaaaaga gtctaggtgc tctctggtgt ggctgcagat      4740
     tctgcacagg ctcggccttt ctgggttggg tgtgtggcct gtgtacttgg ctggaagacg      4800
     ggttttttgt taagtttttt cctctcattg atgggggctg agaccagttt gtgcaacctt      4860
     gacacaacag gtaaagacag gtgaaaagaa ataaaaacgt ttttatgttc ttaaaaaaaa      4920
     aaaaaaaaaa aaa                                                         4933
//