spacer

EBI Dbfetch

ID   BC034839; SV 1; linear; mRNA; STD; MUS; 1165 BP.
XX
AC   BC034839;
XX
DT   06-AUG-2002 (Rel. 72, Created)
DT   23-MAR-2009 (Rel. 100, Last updated, Version 8)
XX
DE   Mus musculus neuregulin 4, mRNA (cDNA clone MGC:40998 IMAGE:3372942),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1165
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1165
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 01c4dfcfef72f800c52629b395ab36a3.
DR   Ensembl-Gn; ENSMUSG00000032311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145784; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Marcello Bento  Soares, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 67 Row: m Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 14030776
CC   The stop codon of the CDS annotated on this record is located > 55
CC   bases upstream of a splice junction, and therefore the mRNA is
CC   predicted to be subject to nonsense-mediated mRNA decay (NMD).
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 37) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1165
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Soares_mammary_gland_NMLMG"
FT                   /clone="MGC:40998 IMAGE:3372942"
FT                   /tissue_type="Mammary gland, lactating mouse"
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..1165
FT                   /gene="Nrg4"
FT   CDS             148..390
FT                   /codon_start=1
FT                   /gene="Nrg4"
FT                   /product="Nrg4 protein"
FT                   /db_xref="MGI:MGI:1933833"
FT                   /db_xref="UniProtKB/TrEMBL:I6L9B2"
FT                   /protein_id="AAH34839.1"
FT                   /translation="MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRFYHLFLRHCL
FT                   LKPFVQLGTLVYPVFLKEFIPLTRPKFSCSVFLNA"
FT   misc_difference 1146..1165
FT                   /gene="Nrg4"
FT                   /note="polyA tail: 20 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1165 BP; 306 A; 280 C; 250 G; 329 T; 0 other;
     gttgctgaag tcctcagtgt tcaaacactt gtgaaacgct gcatgtctag caaaattttc        60
     tttttttatg ggaatataaa tttctgttga ggtgctgatt ttcaacctta attcttccat       120
     caagaatgaa actatttaaa aattaagatg ccaacagatc acgagcagcc ctgtggtccc       180
     aggcacaggt cattttgcct caatgggggg atttgttatg tgatccctac tatccccagc       240
     ccattctgta ggttttatca tttgtttcta agacattgcc tacttaaacc attcgtgcaa       300
     ttgggcacct tggtgtaccc agtgtttctg aaggagttta ttccattgac gcgccccaag       360
     ttctcatgca gtgtgttcct gaatgcttga aatctgtttt ctgcgaatcc ttggtgggat       420
     ggctagaaac ctgtgaaaaa tcatgaaatc accaaatacc atgtgatgtg tatagtctct       480
     ctcctctcca ctgacagctc aatcagggga agtgaactgt tgctggcttc tctttgtctt       540
     attccaagtt gggtcatgag attttccctg caccctggga aggtgcattg aaaattacac       600
     cggagcacgc tgcgaagagg tttttctccc aagctccagc atcccaagcg aaagtaatct       660
     gtcggcagct ttcgtggtgc tggcggtcct cctcactctt accatcgcgg cgctctgctt       720
     cctgtgcagg aagggccacc ttcagagggc cagttcagtc cagtgtgaga tcagcctggt       780
     agagacaaac aataccagaa cccgtcacag ccacagagaa cactgaagac atacatcccc       840
     agtgaagggc atcattacct acaaaggcgg actgtggacc atacgacgag agaagcccat       900
     catcatggat gtgtcccatc atttctatgg cagtcccagg atctcactct tcttgatgct       960
     ctactgtttg attgttcatc gttcacatac agaaatgacg ctggtttcct gtgttgacct      1020
     tgcaccctgc tactgtcatc actggcctgg aagtcagcag tatagataag gctggccctg      1080
     aattcaagag actcacctgt ttttgcctac tcagagttac tggaattaaa ggcataacaa      1140
     cactaaaaaa aaaaaaaaaa aaaaa                                            1165
//


spacer
spacer