spacer

EBI Dbfetch

ID   BC034575; SV 1; linear; mRNA; STD; HUM; 3587 BP.
XX
AC   BC034575;
XX
DT   27-JUL-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens ATPase type 13A2, mRNA (cDNA clone IMAGE:5139467), partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3587
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3587
RA   Director MGC Project;
RT   ;
RL   Submitted (24-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 19614e264c077581e5fd669b29b31514.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 52 Row: h Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
CC   Differences found between this sequence and the human genome (build
CC   35) are described in misc_difference features below and these
CC   differences were also compared to chimpanzee genomic seqeunces
CC   available as of Sep 03, 03.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3587
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_12"
FT                   /clone="IMAGE:5139467"
FT                   /tissue_type="Cervix, carcinoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            <1..3587
FT                   /gene="ATP13A2"
FT                   /note="synonym: HSA9947"
FT   CDS             <1..3268
FT                   /codon_start=2
FT                   /gene="ATP13A2"
FT                   /product="ATP13A2 protein"
FT                   /db_xref="GOA:Q8N4D4"
FT                   /db_xref="H-InvDB:HIT000093478.13"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:Q8N4D4"
FT                   /protein_id="AAH34575.1"
FT                   /translation="RDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAV
FT                   PEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDD
FT                   VHRSRHGLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEALNPYYGFQAFSIALWLADH
FT                   YYWYALCIFLISSISICLSLYKTRKQSQTLRDMVKLSMRVCVCRPGGEEEWVDSSELVP
FT                   GDCLVLPQEGGLMPCDAALVAGECMVNESSLTGESIPVLKTALPEGLGPYCAETHRRHT
FT                   LFCGTLILQARAYVGPHVLAVVTRTGFCTAKGGLVSSILHPRPINFKFYKHSMKFVAAL
FT                   SVLALLGTIYSIFILYRNRVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRRQ
FT                   GIFCIHPLRINLGGKLQLVCFDKTGTLTEDGLDVMGVVPLKGQAFLPLVPEPRRLPVGP
FT                   LLRALATCHALSRLQDTPVGDPMDLKMVESTGWVLEEEPAADSAFGTQVLAVMRPPLWE
FT                   PQLQAMEEPPVPVSVLHRFPFSSALQRMSVVVAWPGATQPEAYVKGSPELVAGLCNPET
FT                   VPTDFAQMLQSYTAAGYRVVALASKPLPTVPSLEAAQQLTRDTVEGDLSLLGLLVMRNL
FT                   LKPQTTPVIQALRRTRIRAVMVTGDNLQTAVTVARGCGMVAPQEHLIIVHATHPERGQP
FT                   ASLEFLPMESPTAVNGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVL
FT                   VQGTVFARMAPEQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVS
FT                   PFTSSMASIECVPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQF
FT                   LAIDLVITTTVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFL
FT                   TLAQPWFVPLNRTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPF
FT                   LVALALLSSVLVGLVLVPGLLQGPLALRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQ
FT                   CLPACLRRLRPKRASKKRFKQLERELAEQPWPPLPAGPLR"
FT   misc_difference 2515
FT                   /gene="ATP13A2"
FT                   /note="'A' in cDNA is 'G' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
FT   misc_difference 3532..3587
FT                   /gene="ATP13A2"
FT                   /note="polyA tail: 56 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 3587 BP; 686 A; 1182 C; 1060 G; 659 T; 0 other;
     aagagacaaa gaggatagtt cctggcagct cttcactgtc caggtgcaga ctgaggccat        60
     cggcgagggc agcctggagc cgtccccaca gtcccaggca gaggatggcc ggagccaggc       120
     ggcagttggg gcggtaccag agggtgcctg gaaggatacg gcccagctcc acaagagcga       180
     ggaggcggtg agtgtcggac agaagcgggt gctgcggtat tacctcttcc agggccagcg       240
     ctatatctgg atcgagaccc agcaagcctt ctaccaggtc agcctcctgg accatggccg       300
     ctcttgtgac gacgtccacc gctcccgcca tggcctcagc ctccaggacc aaatggtgag       360
     gaaggccatt tacggcccca acgtgatcag cataccggtc aagtcctacc cccagctgct       420
     ggtggacgag gcactgaacc cctactatgg gttccaggcc ttcagcatcg cgctgtggct       480
     ggctgaccac tactactggt acgccctgtg catcttcctc atttcctcca tctccatctg       540
     cctgtcgctg tacaagacca gaaagcaaag ccagactcta agggacatgg tcaagttgtc       600
     catgcgggtg tgcgtgtgcc ggccaggggg agaggaagag tgggtggact ccagtgagct       660
     agtgcccgga gactgcctgg tgctgcccca ggagggtggg ctgatgccct gtgatgccgc       720
     cctggtggcc ggcgagtgca tggtgaatga gagctctctg acaggagaga gcattccagt       780
     gctgaagacg gcactgccgg aggggctggg gccctactgt gcagagacac accggcggca       840
     cacactcttc tgcgggaccc tcatcttgca ggcccgggcc tatgtgggac cgcacgtcct       900
     ggcagtggtg acccgcacag ggttctgcac ggcaaaaggg ggcctggtga gctccatctt       960
     gcacccccgg cccatcaact tcaagttcta taaacacagc atgaagtttg tggctgccct      1020
     ctctgtcctg gctctcctcg gcaccatcta cagcatcttc atcctctacc gaaaccgggt      1080
     gcctctgaat gagattgtaa tccgggctct cgacctggtg accgtggtgg tgccacctgc      1140
     cctgcctgct gccatgactg tgtgcacgct ctacgcccag agccgactgc ggagacaggg      1200
     cattttctgc atccacccac tgcgcatcaa cctggggggc aagctgcagc tggtgtgttt      1260
     cgacaagacg ggcaccctca ctgaggacgg cttagacgtg atgggggtgg tgcccctgaa      1320
     ggggcaggca ttcctgcccc tggtcccaga gcctcgccgc ctgcctgtgg ggcccctgct      1380
     ccgagcactg gccacctgcc atgccctcag ccggctccag gacacccccg tgggcgaccc      1440
     catggacttg aagatggtgg agtctactgg ctgggtcctg gaggaagagc cggctgcaga      1500
     ctcagcattt gggacccagg tcttggcagt gatgagaccc ccactttggg agccccagct      1560
     gcaggcaatg gaggagcccc cggtgccagt cagcgtcctc caccgcttcc ccttctcttc      1620
     ggctctgcag cgcatgagtg tggtggtggc gtggccaggg gccactcagc ccgaggccta      1680
     cgtcaaaggc tccccggagc tggtggcagg gctctgcaac cccgagacag tgcccaccga      1740
     cttcgcccag atgctgcaga gctatacagc tgctggctac cgtgtcgtgg ccctggccag      1800
     caagccactg cccactgtgc ccagcctgga ggcagcccag caactgacga gggacactgt      1860
     ggaaggagac ctgagcctcc tggggctgct ggtcatgagg aacctactga agccgcagac      1920
     aacgccagtt atccaggctc tgcgaaggac ccgcatccgc gccgtcatgg tgacagggga      1980
     caacctgcag acagcggtga ctgtggcccg gggctgtggc atggtggccc cccaggagca      2040
     tctgatcatc gtccacgcca cccaccctga gcggggtcag cctgcctctc tcgagttcct      2100
     gccgatggag tcccccacag ccgtgaatgg cgttaaggat cctgaccagg ctgcaagcta      2160
     caccgtggag ccagaccccc gatccaggca cctggccctc agcgggccca cctttggtat      2220
     cattgtgaag cacttcccca agctgctgcc caaggtcctg gtccagggca ctgtctttgc      2280
     ccgcatggcc cctgagcaga agacagagct ggtgtgcgag ctacagaagc ttcagtactg      2340
     cgtgggcatg tgcggagacg gcgccaatga ctgtggggcc ctgaaggcgg ctgatgtcgg      2400
     catctcgctg tcccaggcag aagcctcagt ggtctcaccc ttcacctcga gcatggccag      2460
     tattgagtgc gtgcccatgg tcatcaggga ggggcgctgt tcccttgaca cttcattcag      2520
     cgtcttcaag tacatggctc tgtacagcct gacccagttc atctccgtcc tgatcctcta      2580
     cacgatcaac accaacctgg gtgacctgca gttcctggcc atcgacctgg tcatcaccac      2640
     cacagtggca gtgctcatga gccgcacggg gccagcgctg gtcctgggac gggtgcggcc      2700
     accgggggcg ctgctcagcg tgcccgtgct cagcagcctg ctgctgcaga tggtcctggt      2760
     gaccggcgtg cagctagggg gctacttcct gaccctggcc cagccatggt tcgtgcctct      2820
     gaacaggaca gtggccgcac cagacaacct gcccaactac gagaacaccg tggtcttctc      2880
     tctgtccagc ttccagtacc tcatcctggc tgcagccgtg tccaaggggg cgcccttccg      2940
     ccggccgctc tacaccaatg tgcccttcct ggtggccctg gcgctcctga gctccgtcct      3000
     ggtgggcctt gtcctggtcc ccggcctcct gcaggggccg ctggcgctga ggaacatcac      3060
     tgacaccggc ttcaagctgc tgctgctggg tctggtcacc ctcaacttcg tgggggcctt      3120
     catgctggag agcgtgctag accagtgcct ccccgcctgc ctgcgccgcc tccggcccaa      3180
     gcgggcctcc aagaagcgct tcaagcagct ggaacgagag ctggccgagc agccctggcc      3240
     gccgctgccc gccggccccc tgaggtagtg caggcccacg ggcaccccag acactggaac      3300
     tccctgcctc tgagccacca actggacccc tctccagcaa caccaccgcc accacctccc      3360
     acatccctga ggttggcgac tgtctacact cctcccccga gaccaccccc accctgggga      3420
     agcgttgact actgtcccct accttggacc atcccgcgta ggggtggcag cccccagctc      3480
     ccctcagtgc tgctgtcagt gtagcaaata aagtcatgat attttcctgg ccaaaaaaaa      3540
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                    3587
//


spacer
spacer