Dbfetch

ID   BC034157; SV 1; linear; mRNA; STD; HUM; 723 BP.
XX
AC   BC034157;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   28-OCT-2006 (Rel. 89, Last updated, Version 7)
XX
DE   Homo sapiens annexin A1, mRNA (cDNA clone IMAGE:4733055), complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-723
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-723
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 28d93d7f5111954e696096daa08c9070.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: CLONTECH
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 41 Row: n Column: 15
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..723
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_79"
FT                   /clone="IMAGE:4733055"
FT                   /tissue_type="Placenta"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:9606"
FT   gene            1..723
FT                   /gene="ANXA1"
FT   misc_difference 33^34
FT                   /gene="ANXA1"
FT                   /note="2 bases in the human genome, GT, are not found in
FT                   cDNA."
FT   CDS             189..332
FT                   /codon_start=1
FT                   /gene="ANXA1"
FT                   /product="ANXA1 protein"
FT                   /db_xref="GOA:Q05BR2"
FT                   /db_xref="H-InvDB:HIT000093354.13"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniProtKB/TrEMBL:Q05BR2"
FT                   /protein_id="AAH34157.1"
FT                   /translation="MVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCG
FT                   GN"
FT   misc_difference 619..723
FT                   /gene="ANXA1"
FT                   /note="polyA tail: 105 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 723 BP; 307 A; 96 C; 116 G; 204 T; 0 other;
     aaggtgtgtg tgtgtgtgtg tgtgtgtgtg tgtatagcta gtttctctat agaaattata        60
     tggaagagta agaaggcttc actttaaaat tcatgttttt aatgagagta ttttctgaat       120
     atgagacact taccctcatt tattttggcc agggtgttgg aactcgccat aaggcattga       180
     tcaggattat ggtttcccgt tctgaaattg acatgaatga tatcaaagca ttctatcaga       240
     agatgtatgg tatctccctt tgccaagcca tcctggatga aaccaaagga gattatgaga       300
     aaatcctggt ggctctttgt ggaggaaact aaacattccc ttgatggtct caagctatga       360
     tcagaagact ttaattatat attttcatcc tataagctta aataggaaag tttcttcaac       420
     aggattacag tgtagctacc tacatgctga aaaatatagc ctttaaatca tttttatatt       480
     ataactctgt ataatagaga taagtccatt ttttaaaaat gttttcccca aaccataaaa       540
     ccctatacaa gttgttctag taacaataca tgagaaagat gtctatgtag ctgaaaataa       600
     aatgacgtca caagacaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       660
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       720
     aaa                                                                     723
//