spacer

EBI Dbfetch

ID   BC034108; SV 1; linear; mRNA; STD; MUS; 3373 BP.
XX
AC   BC034108;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 13)
XX
DE   Mus musculus guanine nucleotide binding protein (G protein), gamma 7, mRNA
DE   (cDNA clone MGC:31559 IMAGE:4503666), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3373
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3373
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 80589c5b1d8d4c4464233eee53e96208.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118465; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 44 Row: f Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542901.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3373
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:31559 IMAGE:4503666"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3373
FT                   /gene="Gng7"
FT   CDS             86..292
FT                   /codon_start=1
FT                   /gene="Gng7"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma 7"
FT                   /db_xref="GOA:Q61016"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:95787"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61016"
FT                   /protein_id="AAH34108.1"
FT                   /translation="MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARN
FT                   DPLLVGVPASENPFKDKKPCIIL"
FT   misc_difference 3285..3373
FT                   /gene="Gng7"
FT                   /note="polyA tail: 89 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3373 BP; 836 A; 950 C; 828 G; 759 T; 0 other;
     gtgaagcctt tctattggaa cctcagtgct gggacggtgg gacggtgcag ctctctagac        60
     gccaggtcca cgctcatggc cgatgatgtc aggtactaac aacgtcgccc aggcccggaa       120
     gctggtggag cagctgcgca ttgaagctgg gatcgaacgc atcaaggtct ccaaggcctc       180
     gtcagacctg atgggctact gtgagcaaca tgcccgcaac gatcccttgc tggttggcgt       240
     gccagcctct gagaatccat tcaaagacaa aaagccttgc ataattctct agttctctct       300
     ctttctctct ctcttcccca tctctccctc tctttctccc caccccggag gtattggtcc       360
     aatttttcct gtaaggaaaa tatttgaatc cttcccactt tgaattctaa aggaacaaaa       420
     accattgtga atgccgggat cttcctgacc tagctggagt ttatgaaccc aggtggggct       480
     ctgactgtcg cctggcctaa ctgagatgtt agcctcgtca cccccacccc ctcttttcaa       540
     gagtcactac tgtggcccat ttttaaagct ccccttagtt gccttgggga aagggctccg       600
     ttgataaacg ggattgcctt gcaagcgtga ggaccctagg tgcggcgcgg tcctcaggtc       660
     ccacagaaag catgcaggtg cagtgtcaca aggttgtatg tacttcagca cttggtaggc       720
     aaggcagaag ggtccccagg gcttgaggga ctgccattct agttgtcagt aaactccaga       780
     cagaggagga cacccagcct tgacctctgg ctccacccgc gcggggcaca cacaatgcac       840
     cctgtgctgc cctgtgtcct tccagagtgg ccctgtcatg tacacagtga cgccatttct       900
     ccagagacat ggcccattcc agagacgggc atctgggtct ccattcaaag gaagctcttg       960
     ctggtatgac cgagtgtgta attttgtctc ctaagcctga gatccacgtg gtcattggtg      1020
     gctccccatt ttctcccagt tacacagtta tccaggtagt tgtgagggca gaaatgcaga      1080
     ttagttatct ctcgaggtga tcgaggagtg acggggttct ccgtcccaca tcgtgactgt      1140
     ggctccagat ccccctgcct ccttcctagg acaaactatt ttgtaactag ctagaatcca      1200
     agcccctcag tgtggggact gtagccctgg tctgcactcc cagattgggg gattctaggc      1260
     agggctccac ccagaccaca ccccaatgag gatttgggga ctctaggcgg ggctccaccc      1320
     cgaactgcga cctcagcccc ttactggggc attctaggtg gggctctaca ttgaccactc      1380
     ccccagcccc tcactgggag attgtagtct ggggctccac cctgaccacg cccctagacc      1440
     cttgttggta gattctccac agcattctac ccctgagcca ggcctcttct ctttctattt      1500
     tgtgaacaga gccctagagt ccaggctggc ctggaacagg agatcttcct gcctctgtct      1560
     ccagagtacc tacatgacgg tcttgtgctt gcatgcctgg cattggattg gactgaagaa      1620
     aacatgccct ctgtctgtaa cagtgacagt ggcaggtata gggaggacac gacttgggtg      1680
     tgccaatgcg gtgtgcagcc acacacagag gcagcctaag catttgaaag accccagctg      1740
     cctctttctc ctgccagatc agtatgggag caaaccgcag aactgaagcc agtctagttg      1800
     ttccctgtat ccctggtgga aatctgctgc caaaagcctg ggccaggctg atccctgggc      1860
     aaagtgaaag gggtgagcac agttagctca tcttctagcc agttaggcat gacctaccgc      1920
     ctaggtaagg tggcaggctc ccccaaatcc atttgatgga aacaggaaaa gaagtctggg      1980
     gtgtgactaa ggggaggcat tgcaggtgct aagagcgccc ccctcccact tccccctcca      2040
     tgggctgggt cccagagagc acagaccaag ggtctggctt ctgtgcatca gctcccatta      2100
     ctggtcagag agggccagca actttggtca gcctgactct cagaacctgg cttgagtcag      2160
     aaaagccagt ttcccccacc ctcaaactac agccaccttg cattaggcta ggaaccaggt      2220
     cccaggatgt gtgtccccag ctacactggc aaggagaaag gaaagctgga aatctgggga      2280
     ccagggctgc agagcaccca cccagcatgc tggaaagctg ggttccaccc caagctcgaa      2340
     gtaaccaggc acgggcactg gggtaggcag atcaggactt cagggtcttc ctcagctaca      2400
     taatgggctc aaggctaacc tggactacat gagaccatgt ctcaaattca gtgcactctc      2460
     tcactctctc acatcacgac agcagatgcc tgcctggcca gcctgtgtgt ggtcggagca      2520
     ttttgtttct ctcctctggg acaaaaaact caaatctgca tctctgccca cacttccagt      2580
     tctccctccc taggtgactc acaggccaag gacaaagtga cttcttgttc ccaaggaagg      2640
     taggacgtgc ttggctgatg tatccaggat ggaccttggg ccccaatagc ccttgtgtgc      2700
     cctcctaacc actggagccc tgcctcagct tagagatact tagggaaacc agaacacaac      2760
     agagccatca ggagccaaga ttgggggccc tcaccttcaa tcccaacact tgggagacag      2820
     aggcaagggg atctccgtga attcgaggcc agcctcatct acagagtgag ttccaggaca      2880
     gccagggttg tagagacacc gtctaaaaac aaaataaaac aaccaaaact gttagacctg      2940
     ctgcagcttg agccacccag gagggacttc caacctaagg agaaggttgg tgggcatggg      3000
     ggggtgtatc ctacacagaa gccatataca ctggccagat gtcacatggc actttccatt      3060
     tccgtcccca cttcagggct ggctcctccc cctcacgctc cagggctggc tcctacccct      3120
     tcagactcct cccccttccc tctgctttgt gaagctggtt ggtttttatt tctgattaaa      3180
     aaaaaaactt tttcccgtgt gccacgccca ctctcccagt gttactattg tgtggaatga      3240
     ggtcacagga gagtgactcc tccataataa aagcctcgat tttcaaaaaa aaaaaaaaaa      3300
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3360
     aaaaaaaaaa aaa                                                         3373
//


spacer
spacer