Dbfetch

ID   BC034101; SV 1; linear; mRNA; STD; MUS; 3997 BP.
XX
AC   BC034101;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus intraflagellar transport 80 homolog (Chlamydomonas), mRNA
DE   (cDNA clone MGC:31523 IMAGE:4501451), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3997
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3997
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b532b4d8cbe216f4565c15553e608c31.
DR   Ensembl-Gn; ENSMUSG00000027778; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169064; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 44 Row: e Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 28076906.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3997
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:31523 IMAGE:4501451"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3997
FT                   /gene="Ift80"
FT                   /note="synonym: mKIAA1374"
FT   CDS             80..2413
FT                   /codon_start=1
FT                   /gene="Ift80"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas)"
FT                   /db_xref="GOA:Q8K057"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1915509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K057"
FT                   /protein_id="AAH34101.1"
FT                   /translation="MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTS
FT                   ETSLIVKLPDDIYPIDLHWFPKSLGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEA
FT                   HCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVL
FT                   YTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVL
FT                   YGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDG
FT                   TQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKA
FT                   SLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSY
FT                   EGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLS
FT                   HKNEISEIALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDT
FT                   CNILCGIQDTRFTVWYYPNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRA
FT                   DGSLVHISISPYPAILHEYVSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEI
FT                   AYAAVGEIDKVRYINAIKDLPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININ
FT                   LYNWERALELAVKYKTHVDTVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKI
FT                   EMEITKERDRSSSGQSSKSVGLKH"
FT   misc_difference 3400^3401
FT                   /gene="Ift80"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 3982..3997
FT                   /gene="Ift80"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3997 BP; 1206 A; 775 C; 891 G; 1125 T; 0 other;
     gagagcagtc gccaccgctt tcctggaact tgagtgaata caatcaagcg gtatttaaca        60
     tttctctgga actggagaca tgagactgaa gatatctctc tcaaaggaac caaagcatca       120
     agaattagtg agctgtgtgg gttggactac ggcggaggag ctgtactcat gcagtgacga       180
     ccaccagatc gtcaagtgga acctgctaac cagtgaaacc agcctaatag tcaagctgcc       240
     tgatgacatc tacccgatag accttcactg gtttccaaag agtttaggca taaagaaaca       300
     gacgcaggca gaaagcttcg tcctcacaag ctctgatggt aagtttcatc tgatttccaa       360
     gttaggaaga gtggaaaaga gtgtagaagc tcactgtggg gctgtgctcg caggacgatg       420
     gaattatgag gggactgcat tagtgacagt tggagaagat ggacaagtga aaatctggtc       480
     aaagacaggg atgctcagat caactttagc ccagcaagga acaccagtgt actcagtagc       540
     ctggggccct gattcagaaa aggttcttta tacagcaggc aaacagctca tcattaaacc       600
     tcttcaacca aatgctaaag ttttacagtg gaaagcccat gatggcatca ttttaaaagt       660
     cgactggaac tcagtgaatg accttatttt atctgcgggt gaagactgta agtataaggt       720
     ttgggatagt tatggccgcg tgctgtacgg ctcccagcct catgagcacc ccatcacctc       780
     agtggcctgg gctccagatg gggagttatt tgccgttgga tcgtttcata cgttacgctt       840
     gtgtgataaa actgggtggt catatgcttt agagaaaccc aacactggca gcatatttaa       900
     cattgcgtgg tctattgatg gcactcagat cgcgggagcc tgtgggaacg ggcatgttgt       960
     ctttgcacat gtggtggagc agcgctggga gtggaaaaat tttcaagtaa cgctaacgaa      1020
     gagaaggacc atgcaggttc gcaacgttct caatgatgcc gtggatctcc tggagttccg      1080
     ggacagagtc attaaagcat ccttaaacca cgcacacttg gtggtctcca cgtccctgca      1140
     gtgctacgtg ttctctacga agaactggaa tacaccactt atatttgatc tcaaagaagg      1200
     aactgttagt ttaattctgc aggcagaaag acattttctt ctggtggatg gcgggggtat      1260
     ctacctgcac tcttatgaag ggcgcttcat ttcttctcca aagtttcctg gcatgagaac      1320
     agacatcctg aacgctcaga ctgtgtctct gagcaatgac acgatagcaa taaaggacaa      1380
     agctgacgag aagataatct tcctctttga ggcgtcaact ggaaaacccc taggggatgg      1440
     gaaacttctt tctcataaga atgaaatctc agaaattgct ctggatcaaa aaggacttac      1500
     caatgacaga aaaattgctt tcattgacaa gaacagagat ctctacatca cctctgtgaa      1560
     acgatttggg aaagaagaac agattattaa acttggaacc atggtacata ctttggcatg      1620
     gtgtgataca tgcaatatcc tctgtggaat tcaagatact cgattcacag tatggtatta      1680
     ccctaatacc atttatgtgg acagagacat tctgcctaaa acattgtacg aaagagatgc      1740
     aagtgaatat agtaaaaacc cgcatatagt gagttttgtt ggaaatcagg taactataag      1800
     aagagctgat ggctccctgg tgcacatcag catatcaccg taccccgcca tcctccatga      1860
     gtatgtgagc agctccaagt gggaagaggc tgtaaggctt tgccgctttg ttaaggagca      1920
     aagcatgtgg gcttgcctag cggctatggc tgttgctaat cgagatatgg tcactgcaga      1980
     aatagcctat gcagcagttg gggaaattga taaagttcgg tacatcaatg ctataaaaga      2040
     tcttccatct agagagtcaa aaatggccca catactcatg tttagtggga acatccagga      2100
     ggctgaaaca gtcctgctcc aggctggcct tgtttatcaa gccatacaga tcaacattaa      2160
     tctctataac tgggaaaggg cgctggagtt ggctgtaaaa tacaaaaccc acgttgatac      2220
     agtgctcgct tatcgtcaga agttcttgga cacatttggt aaacaggaaa ctaataaacg      2280
     atatttacaa tatgcagagg gcctccaaat agactgggag aaaatcaaag ccaaaattga      2340
     gatggaaatt actaaagaac gagaccgatc atccagcggc cagtccagca agagtgtggg      2400
     cttaaagcac taagggccac gcttacctcc aaactagttt ggactaacca aagatgtgca      2460
     tgtttgtttg ctttaagaag aaaaaaaagc ataattttaa gactagtgct tcctctagat      2520
     ggtagtgcac ttgcctagca tacatgaggc cctggggctc atccccagtc aaaagaaaaa      2580
     ggcattgtct ttgaataagt gtatgagttt tctgtgtttt taatacttaa ggtacgttca      2640
     gaaaggttaa gcccaaaata ccttatataa ttccatcatt tctatttttc tagtctaata      2700
     attaagaaaa tatttctata tgcttatcta tgcccaagga gtgttgagta cattccagtt      2760
     tgtttgtttg tttgttcctt tatttctgtt tttttcagta taaataggta ttcttataat      2820
     aaagccttga gttatttaca atgtatgtta ttctgattgt atgtattcta tttgatatat      2880
     aaattgtaaa gtatcttcca tactttatga aacaaaaata caggagaaag ggtttgggga      2940
     aaatggtaca atgtagatgt atatcgaagt ttatagttca cataacaaac gctgggaaca      3000
     gctatggtat ccatcagcta caattagata aaaccacgtg gtattcaccg gcagtgatta      3060
     gtctctcata gaagggttga gctgtggcac atgccgcaac gtggatgagc ctaggagaac      3120
     ttccactacg tgaagtaggt tagacatggc acagacgtca gtcctgcggg gctcacacaa      3180
     ggcactcgga ttaagtaagt tcttctggtc agaaaagagg caagagggac aggccctgga      3240
     ggagggaatt cattgtgtaa cgctggccat tgctgcttgg ggtgagagcc ctagaaatgg      3300
     agagtggtga tggttgtata gcatcgtggg tgttgtgaac tccgttgtcc tctttaaaag      3360
     gattaaaatg ataaattttc tttccagttg tttttttttt aaaccatatt gaaaaagtag      3420
     tcaaactgct tttgttgttg ttgttactct attgacaaag ttggtaaact gcattttctt      3480
     cattcttccc tgacttcaga atatttgggc ctcagactta gagtctaaat tttcaaaact      3540
     ctcctcactg gatgaccctg tttgtctggc tttaatataa tgcatcccca agtccccaaa      3600
     agctttttaa cagtgacaca gacatccctc taaagtgccc ttgaccctgc tcttagaatt      3660
     ggtgcattac agagctcatg cacactaatt gggaaaaaca tcaccccttt ccctccactg      3720
     taatttctca tgtaggtttt gttcatagaa atgccccata gttcccaata tgtacctttt      3780
     cttttatgaa atgttggact gttcaattct tagtctagag tttggataca cagatatgtt      3840
     caattcatga aatctaagca attgacttat atgttataca tgctttctac tttgttaaat      3900
     ttcagtgtaa tgtttcaaaa gaaaaaaatg gttaaatttt atgtttagta tgtttaccac      3960
     aataaaaagg ttaaaaaaaa aaaaaaaaaa aaaaaaa                               3997
//