Dbfetch

ID   BC034092; SV 1; linear; mRNA; STD; MUS; 3623 BP.
XX
AC   BC034092;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus membrane metallo endopeptidase, mRNA (cDNA clone MGC:31469
DE   IMAGE:4483558), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3623
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3623
RA   Strausberg R.;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 59bf1057ae5b38c25e6bdc8382be75cf.
DR   Ensembl-Gn; ENSMUSG00000027820; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027261; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027221; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027191; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027234; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026977; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027680; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026429; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026953; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027087; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027055; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027198; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027072; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027738; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026161; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026503; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000029400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194150; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061036; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0061054; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0060989; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060981; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060673; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061459; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060974; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0060651; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0060742; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0060733; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0060895; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060700; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061646; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060528; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059953; mus_musculus_wsbeij.
DR   EuropePMC; PMC1851605; 17389375.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 44 Row: b Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678889.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3623
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:31469 IMAGE:4483558"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3623
FT                   /gene="Mme"
FT                   /note="synonyms: NEP, CD10, CALLA, 6030454K05Rik"
FT   CDS             111..2363
FT                   /codon_start=1
FT                   /product="Mme protein"
FT                   /db_xref="GOA:Q61391"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="MGI:MGI:97004"
FT                   /db_xref="PDB:2YVC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61391"
FT                   /protein_id="AAH34092.1"
FT                   /translation="MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   SNFDILRDELEVILKDVLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLKLLPD
FT                   IYGWPVASDNWDQTYGTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMELEK
FT                   EIANATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGKSFSWSNFTNEIMSTVNINIQN
FT                   EEEVVVYAPEYLTKLKPILTKYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW"
FT   misc_feature    324..2360
FT                   /note="PepO; Region: Predicted metalloendopeptidase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
XX
SQ   Sequence 3623 BP; 1259 A; 679 C; 732 G; 953 T; 0 other;
     gtgaccgaga gcagcgctgc caaattgcac cggggttcat ttgggggctg ggaattggcc        60
     attccgctgt acagacactg tttttatttt aaaaaacaag attttaggtg atgggaagat       120
     cagaaagtca gatggatata actgatatca atgctccaaa gccaaagaag aaacagcgat       180
     ggactcccct ggagatcagc ctctctgtgc ttgtcttgct cctgactatc atagcggtga       240
     caatgatcgc tctctatgca acctatgatg atggcatttg caaatcatca gactgcataa       300
     aatcagctgc tcgactgatt cagaatatgg atgcctctgt tgagccatgt acagacttct       360
     tcaagtatgc ttgtggaggc tggttgaaac gcaacgtcat tcccgagacc agttcccgat       420
     acagtaattt tgacatttta agagatgagc tagaagtcat tttgaaagat gtccttcaag       480
     aacccaaaac tgaagacata gtagcagtgc agaaagcaaa aaccttgtac agatcgtgta       540
     taaatgagtc tgctattgat agcagaggcg gacaacctct actcaaactg ttaccagata       600
     tatatgggtg gccagtagca tcagataact gggatcaaac atatggcact tcttggacag       660
     ctgagaaatc cattgcacaa ctgaattcta aatatgggaa aaaggtcctc attaattttt       720
     ttgttggcac tgatgataag aattctaccc agcatataat tcattttgac cagcctcgac       780
     ttggcctccc ttccagagac tactatgagt gcactggaat atataaagag gcttgcacag       840
     catatgtgga ttttatgatt tctgtggcca gactgattcg tcaggaacaa agtttgccta       900
     ttgatgaaaa ccagctctct ttggaaatga ataaagttat ggaattggaa aaagaaattg       960
     ccaatgctac aactaaacca gaagaccgaa atgacccaat gctgctttat aacaaaatga      1020
     cattggccaa gctgcagaac aacttttccc tggaggtcaa tgggaagtca ttcagctggt      1080
     caaatttcac aaatgaaatc atgtcaactg tgaatattaa tattcaaaat gaggaagaag      1140
     ttgttgtcta tgctccagaa tatttaacca aacttaagcc tattcttacc aaatattctc      1200
     ccagagatct tcaaaattta atgtcctgga ggttcataat ggatcttgta agcagcctca      1260
     gccgaaacta caaggagtcc agaaatgctt tccgcaaggc cctttatggg actacatcag      1320
     aaactgcaac atggagacgg tgtgctaact acgtcaatgg gaatatggag aatgctgtgg      1380
     ggaggcttta tgtggaagcg gcttttgctg gagagagcaa gcacgtggtt gaagacttga      1440
     ttgcacaaat ccgggaagtt tttattcaga ctttggatga ccttacttgg atggatgctg      1500
     agacaaaaaa gaaagctgaa gaaaaggcct tggcaattaa agaaaggatt ggctatcctg      1560
     atgacatcat ttccaatgag aacaaactga ataatgagta tcttgagttg aactacaggg      1620
     aagatgaata ctttgagaac ataattcaaa atttgaaatt cagccaaagc aagcagctaa      1680
     agaagctccg agaaaaagtg gacaaagatg agtggataag tggagcagct gtagtcaatg      1740
     cattttattc ctcaggccga aatcagatag tcttccccgc tggcattttg cagcccccat      1800
     tcttcagtgc tcagcaatcc aactcattga actatggggg catcggcatg gtcattggac      1860
     atgaaatcac acatggattt gatgacaatg gaagaaattt caataaagat ggagacctcg      1920
     ttgactggtg gacgcagcag tcggcaaata attttaaaga ccaatcccag tgtatggtat      1980
     accagtatgg aaacttttcc tgggacctag caggtggaca gcatctcaat ggaattaata      2040
     cactaggaga aaacattgct gataatggag gtattggcca agcatacaga gcctatcaga      2100
     attatgttaa aaagaatggt gaagaaaaat tactccctgg acttgacctc aatcacaaac      2160
     aactattttt cctgaacttt gcccaggtgt ggtgtgggac ctaccggcca gagtatgcag      2220
     tcaattctat taaaacagat gtacacagtc ctggaaattt caggatcatt gggactttgc      2280
     agaactctgc cgagtttgca gatgcctttc attgccgcaa gaattcatac atgaatccag      2340
     aaaggaaatg tcgggtttgg tgatcttcac aagatactga acatccacgg caagatttgc      2400
     caaagccacg gaaacaggaa ctcttccctc agagaaactg ggccccggaa gtttcttcag      2460
     cttcctgggg ggcaattcac agagacgagc atgagctaac ataaatgaaa ttagattatt      2520
     aaatctgctg tgaatgaaag gggagggagc ctacgatcta gcaaatcaat cacttcactg      2580
     tgtaaataat gattactttc caacggtagt actaccgttc acttctgttt ctcacacaga      2640
     ctgcagcttt catgttgtct gtagagagga gtgttaacac ttaaagcaga ctatgacttc      2700
     tgatcaaaaa gaggacgatg ctcagtacag cagggcacca aagcacagat ttgcccctca      2760
     gcactcactt ttgtttgcaa cattcatgct ccttccaaac tctcccaaag aactcccata      2820
     cagactgtgg ccttcaggct cgtgcagttt tgaactcatt ttaccataca taagttattc      2880
     attcattcca catcaattta gtttgaacac tcttagagct taaactagag tatctgaaac      2940
     ggttccccta tttcacccac tttagtgatg ttgagattct tgaacccccc tgcagatctt      3000
     tgagcaattt cttgctcttg ctgcccctca gactcagtct tttaaaggat ttgtagtaat      3060
     gtataaagaa taattctata tttaattatt aactacattt atgactgaat aaaccattgc      3120
     tataggtaat cattgaatat tgaagttata tggccaagat agttttgaag atctgtaaca      3180
     tgatatacag acaaaaattt gagactcttt aaatctgtaa atcatattga tgaaaagctt      3240
     taagtacaaa ctctgggggt gagcattacc attggacggg tgtcttgaga tacataatag      3300
     ttgtggttta caaacagcat tttcaagatt aagtctgtcc ctagtggcta agaaagggtc      3360
     taactgtatc tgtgttgctc catgaatgct tagccttcag gtttgtcatc aaatgaaaat      3420
     attttgataa taaattgacg ttgtgagccc cttaaaaaaa aaaaaaaaaa aaaaaaaaaa      3480
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3540
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3600
     aaaaaaaaaa aaaaaaaaaa aaa                                              3623
//