spacer

EBI Dbfetch

ID   BC034074; SV 1; linear; mRNA; STD; MUS; 3030 BP.
XX
AC   BC034074;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus leucine-rich repeat kinase 2, mRNA (cDNA clone IMAGE:4221345),
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3030
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3030
RA   Director MGC Project;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; b2662dfaebbb02f93d61f8e4160238a6.
DR   Ensembl-Gn; ENSMUSG00000036273; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060642; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 43 Row: k Column: 19.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3030
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="IMAGE:4221345"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..3030
FT                   /gene="Lrrk2"
FT                   /note="synonym: cI-46"
FT   CDS             <1..2524
FT                   /codon_start=2
FT                   /gene="Lrrk2"
FT                   /product="Lrrk2 protein"
FT                   /db_xref="GOA:Q5S006"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020859"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1913975"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5S006"
FT                   /protein_id="AAH34074.1"
FT                   /translation="SEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRM
FT                   YWRQGIYLNWSPEAYCLVGSEVLDNRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEW
FT                   FPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTI
FT                   PISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFN
FT                   KHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTR
FT                   TLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRM
FT                   GIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDEL
FT                   AIQGKLPDPVKEYGCAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHIL
FT                   IPKNIIVECMVATNLNSKSATLWLGCGNTEKGQLSLFDLNTERYSYEEVADSRILCLAL
FT                   VHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFL
FT                   LVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTK
FT                   VFSFSNDFTIQKLIETKTNQLFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTE
FT                   KLCELIDCVHFLKEVMVKLNKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLS
FT                   TRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLN
FT                   LPHEVQNLEKHIEVRTELADKMRKTSVE"
FT   misc_difference 238
FT                   /gene="Lrrk2"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2449
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2531
FT                   /gene="Lrrk2"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2588
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2600
FT                   /gene="Lrrk2"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2697
FT                   /gene="Lrrk2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2726
FT                   /gene="Lrrk2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2764
FT                   /gene="Lrrk2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2831
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2921
FT                   /gene="Lrrk2"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3018..3030
FT                   /gene="Lrrk2"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3030 BP; 907 A; 589 C; 691 G; 843 T; 0 other;
     ctctgagatc atcatccggc tgtacgaaat gccgtacttt cccatgggat tttggtcaag        60
     attgattaac cgattacttg aaatctcacc cttcatgctt tctggcagag agagagcact       120
     acgccctaac aggatgtatt ggcggcaagg catctacttg aattggtctc cagaagcata       180
     ctgtctggta ggctctgaag tcttagacaa tcgacctgag agtttcttga aaatcacggt       240
     tccgtcttgt agaaaaggtt gtattcttct gggccgagtt gtggatcata ttgactcact       300
     catggaagaa tggtttcccg ggttactgga gattgacatt tgtggggaag gagaaactct       360
     gttgaagaaa tgggcattgt acagttttaa tgatggtgaa gaacatcaga agatcttgct       420
     tgatgagttg atgaagaagg ctgaagaagg agacctgtta ataaatccag accaaccaag       480
     gctcactatt ccaatatccc agattgctcc ggacttgatc ttggctgacc tgcctagaaa       540
     tatcatgttg aacaatgatg agttggaatt tgaggaagca ccagagtttc tcttaggcga       600
     tggaagtttt ggatccgttt atcgagctgc ctacgaagga gaggaagtgg ctgtgaagat       660
     ttttaataag cacacatctc ttaggctgtt aagacaagag ttggtggtcc tttgtcacct       720
     tcaccacccc agcctgatat ccttgctggc ggctggtatt cgtcctcgga tgttggtaat       780
     ggagttggcc tccaaaggtt ccttggatcg cctgctgcag caggacaaag ccagcctcac       840
     cagaaccctc cagcacagga tcgcgttgca tgtggccgac ggcctgaggt atctccactc       900
     agccatgatt atttaccgtg acctgaagcc ccacaatgtg ctgcttttta ccctgtatcc       960
     caatgctgcc atcattgcga agattgcgga ctacgggatc gcacagtact gctgcaggat      1020
     gggaataaag acatcagagg gcaccccagg gttccgggca cctgaagttg ccagggggaa      1080
     tgtcatttat aaccaacagg ccgatgttta ttcttttggc ttactacttc acgatatttg      1140
     gacaactggg agtaggatta tggagggttt gaggttccca aatgagtttg atgagttagc      1200
     catacaaggg aagttgccag atccagttaa agaatatggc tgtgccccat ggcctatggt      1260
     tgagaagtta attacaaagt gtttgaaaga aaatcctcaa gaaagaccca cttctgccca      1320
     ggtctttgac attttgaatt cggctgaatt aatttgcctc atgcgacaca ttttaatacc      1380
     taagaacatc attgttgaat gcatggttgc cacgaatctc aatagcaaga gtgcgactct      1440
     ctggttggga tgtgggaaca cagaaaaagg acagctttcc ttatttgact taaacacgga      1500
     aagatacagc tatgaggaag ttgctgatag tagaatactg tgcttggctt tggtgcatct      1560
     cgctgctgag aaagagagct gggttgtgtg cgggacacag tctggggctc tcctggtcat      1620
     caatgttgaa gaggagacaa agagacacac cctggaaaag atgactgatt ctgtcacttg      1680
     tttgcattgc aattcccttg ccaagcagag caagcaaagt aactttcttt tggtgggaac      1740
     tgctgatggt aacttaatga tatttgaaga taaagccgtt aagtgtaaag gagctgcccc      1800
     cttgaagaca ctacacatag gcgatgtcag tacgcccctg atgtgcctga gcgagtccct      1860
     gaattcatct gaaagacaca tcacatgggg agggtgtggc acaaaggtct tctccttttc      1920
     caatgatttc accattcaga aactcatcga gacaaaaacc aaccagctgt tttcttacgc      1980
     agctttcagc gattctaaca tcatagcgct ggcagtagac acagccctgt atattgccaa      2040
     gaaaaacagc cctgtcgtag aggtgtggga caagaaaaca gaaaagctct gtgaattaat      2100
     agactgtgtg cacttcttaa aggaggtgat ggtaaaacta aacaaggaat cgaaacatca      2160
     gctgtcctac tctgggaggg tgaaggccct ctgcctgcag aagaacacgg ctctctggat      2220
     cggaactgga ggaggccaca tcttactcct ggatctttct actcggcgag ttatccgcac      2280
     cattcacaat ttctgtgatt ctgtgagagc catggccaca gcacaattag gaagccttaa      2340
     gaatgtcatg ctggttttgg ggtacaagcg gaagagtaca gagggtatcc aagaacaaaa      2400
     agagatacaa tcttgtttgt ctatttggga cctcaatctt ccacacgaag tgcaaaattt      2460
     agaaaaacac attgaagtaa gaacagaatt agctgataaa atgaggaaaa catctgttga      2520
     atagaaagac gtcaggcagt ctcgatgtta tattgaataa gacatcagac atcctcgtca      2580
     ctatattaaa aaggacatcg gacatcctcg ccaatatgtt agaaaatgta ctcttctttt      2640
     taaaatatat ttttaaaatg tttacattga aaagagtatg cctattcttt acaaagctca      2700
     tatgtatatg aaggaatgtg tatgttttat gtttaattta atatatgtaa aaatatttat      2760
     cagcaaatat gttttaaaaa actatttaat ttagcattat attttctata ctccttaact      2820
     aatttgaagg aataaacaaa agaaatctac aaagcattta atttcagtat ttatactaaa      2880
     attaataaaa atatcatgtt tgttttgcta tgtattgtga agataaagcc tattttaaat      2940
     tgttgattaa gacacagatg ttgcttgatt atctatggac tcagcggagt agaataaaat      3000
     atctggtcaa tttccaaaaa aaaaaaaaaa                                       3030
//


spacer
spacer