spacer

EBI Dbfetch

ID   BC034064; SV 1; linear; mRNA; STD; MUS; 2869 BP.
XX
AC   BC034064;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus guanylate cyclase 2c, mRNA (cDNA clone IMAGE:4208530), partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2869
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2869
RA   Strausberg R.;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000042638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078095; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 43 Row: h Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2869
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="IMAGE:4208530"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2265
FT                   /codon_start=1
FT                   /gene="Gucy2c"
FT                   /product="Gucy2c protein"
FT                   /db_xref="GOA:Q3UWA6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:106903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UWA6"
FT                   /protein_id="AAH34064.1"
FT                   /translation="SDFSLAYLEGTLLFGHMLQTFLENGENVTGPKFARAFRNLTFQGF
FT                   AGPVTLDDSGDIDNIMSFLYVSLDTRKYKVLMKYDTHKNKTIPVAENPNFIWKNHKLPN
FT                   DVPGLGPQILMIAVFTLTGILVVLLLIALLVLRKYRRDHALRQKKWSHIPSENIFPLET
FT                   NETNHISLKIDDDRRRDTIQRVRQCKYDKKKVILKDLKHSDGNFSEKQKIDLNKLLQSD
FT                   YYNLTKFYGTVKLDTRIFGVVEYCERGSLREVLNDTISYPDGTFMDWEFKISVLNDIAK
FT                   GMSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQATIS
FT                   QKGDVYSFAIIAQEIILRKETFYTLSCRDHNEKIFRVENSYGKPFRPDLFLETADEKEL
FT                   EVYLLVKSCWEEDPEKRPDFKKIESTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEH
FT                   LVEERTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTI
FT                   CKYSTPMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRNGNRHAVDISK
FT                   MALDILSFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRME
FT                   STGLPLRIHMSSSTIAILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKDQEYNLPSP
FT                   PTVENQQRLQTEFSDMIVSALQKRQASGKKSRRPTRVASYKKGFLEYMQLNNSDHDSTY
FT                   F"
XX
SQ   Sequence 2869 BP; 780 A; 681 C; 724 G; 684 T; 0 other;
     agtgactttt ctctcgctta cttggaggga accttgctat ttggacacat gctgcagacg        60
     tttcttgaaa atggagaaaa tgtcacgggt cccaagtttg ctcgtgcatt caggaatctc       120
     acttttcaag gctttgcagg acctgtgact ctggatgaca gtggggacat tgacaacatt       180
     atgtcctttc tgtatgtgtc tctggatacc aggaaataca aggttcttat gaagtacgac       240
     acccacaaaa acaaaactat tccggtggct gagaacccca acttcatctg gaagaaccac       300
     aagctcccca atgacgttcc tgggctgggc cctcaaatcc tgatgattgc tgtcttcacg       360
     ctcacgggga tcctggtagt tctgctgctg attgccctcc ttgtgctgag aaaatacaga       420
     agagatcatg cacttcgaca gaagaaatgg tcccacattc cttctgaaaa catctttcct       480
     ctagagacca acgagaccaa ccacatcagc ctgaagattg acgatgacag gagacgagac       540
     acaatccaga gagtgcgaca gtgcaaatac gacaagaaga aagtgattct gaaagacctc       600
     aagcacagtg acgggaactt cagtgagaag cagaagatag acctgaacaa gttgctgcaa       660
     tctgactact acaacttgac caagttctac ggcaccgtga agctggacac caggatcttt       720
     ggggtggttg agtactgcga gaggggatcc ctccgggaag tgttaaacga cacaatttcc       780
     taccctgacg gcacgttcat ggattgggag tttaagatct ctgtcttaaa tgacatcgct       840
     aaggggatgt cctacctgca ctccagtaag attgaagtcc acgggcgtct caaatccacc       900
     aactgcgtgg tggacagccg catggtggtg aagatcaccg actttgggtg caattccatc       960
     ctgcctccaa agaaagacct gtggacggcc ccggagcacc tgcgccaggc caccatctct      1020
     cagaaaggag acgtgtacag cttcgccatc attgcccagg agatcatcct ccgtaaggag      1080
     actttctaca cgctgagctg tcgggatcac aatgagaaga ttttcagagt ggaaaattca      1140
     tatgggaaac ctttccgccc agacctcttc ctggaaactg cagatgagaa ggagctggag      1200
     gtctatctac ttgtcaaaag ctgttgggag gaggatccag aaaagaggcc agatttcaag      1260
     aaaatcgaga gcacactggc caagatattt ggccttttcc atgaccagaa aaacgagtct      1320
     tacatggaca ccttgatccg acgtctccag ctgtactctc gaaacctgga acatctggtg      1380
     gaggaaagga ctcagctgta caaggcggag agggacaggg ctgaccacct taacttcatg      1440
     ctcctcccac ggctggtggt aaagtcactg aaggagaaag gcatcgtgga gccagagctg      1500
     tacgaagaag tcacaatcta cttcagtgac attgtgggct tcaccaccat ctgcaagtat      1560
     agcacaccca tggaggtggt ggacatgctc aacgacatct acaagagctt tgaccagatt      1620
     gtggaccacc atgacgtcta caaggtagaa accatcggtg acgcctacgt ggtggccagc      1680
     ggtctgccta tgagaaacgg caaccgacac gcggtagaca tttccaagat ggccttggac      1740
     atcctcagct tcatagggac ctttgagttg gagcatctcc ctggcctccc cgtgtggatc      1800
     cgcattggag ttcattctgg cccctgcgct gctggtgttg tggggatcaa gatgcctcgc      1860
     tattgcctgt ttggagacac tgtcaacact gcctccagga tggaatccac cggcctcccc      1920
     ttgaggattc acatgagcag ctccaccata gccatcctga agagaacgga ttgtcagttc      1980
     ctgtatgaag tgaggggaga aacatactta aagggaagag ggacagaaac cacatactgg      2040
     ctgactggga tgaaggacca agaatacaac ctgccatccc caccgacagt ggagaaccaa      2100
     cagcgcctgc agactgagtt ctcagacatg atcgttagcg ccttacagaa aagacaggcc      2160
     tcgggcaaga agagccggag gcccactcgg gtggccagct ataagaaagg ctttctggaa      2220
     tacatgcagc tgaacaattc agaccacgat agcacctatt tttagaccaa gtgaggtctg      2280
     agaactgaca gtagcaacct cctatatcat gaatctgtat tttccagaga cctcaacaac      2340
     acaggcaagc gcttagcctc agtgccctgc ctggaacgta gaaccaaccc ctcaagtcat      2400
     gtgggtgttc tgattttggg ttggtggttg gttggttggt tggttggttt tggttttgtt      2460
     gagacagagt ttcgtgtatc ccaagctggc ctcaaaccca ctgtgtagca gcagatgacc      2520
     ttggacttct aagatcatcc gtgtgtgttc ctgacagtgt gatgagtgta taggtcagag      2580
     ccctgtccca cagttctcca tggagcatca acctgaattg aggagcgagg aggggaatgt      2640
     cctgtgctgt acagaacttg gggttttgtt ctaatttcat ctctggtttg gttttgtttt      2700
     ctggctcctt ccctctctat gtgtgagaga agtttttaaa ttgtctgaat tgtatgctaa      2760
     gtagcttatc tccaagaaag tgtgtttaac tagtgatttt tgcagaaacc atgctggata      2820
     ttaggtaaaa aaataaaagt gtttagagtc tgaaaaaaaa aaaaaaaaa                  2869
//


spacer
spacer