spacer

EBI Dbfetch

ID   BC033827; SV 1; linear; mRNA; STD; HUM; 1229 BP.
XX
AC   BC033827;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens major histocompatibility complex, class II, DR beta 1, mRNA
DE   (cDNA clone MGC:45344 IMAGE:5216243), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1229
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1229
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 71d6496395aedd439d2f55a20ca41b48.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Life Technologies, Inc.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 68 Row: p Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 26665892.
CC   Differences found between this sequence and the human reference
CC   genome (build 35) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1229
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_118"
FT                   /clone="MGC:45344 IMAGE:5216243"
FT                   /tissue_type="Blood, adult leukocytes"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1229
FT                   /gene="HLA-DRB1"
FT                   /note="synonyms: DRB1, HLA DRB1"
FT   CDS             44..844
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="HLA-DRB1 protein"
FT                   /db_xref="GOA:P01911"
FT                   /db_xref="H-InvDB:HIT000041984.20"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1BX2"
FT                   /db_xref="PDB:1YMM"
FT                   /db_xref="PDB:2WBJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01911"
FT                   /protein_id="AAH33827.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAV
FT                   DTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   misc_difference 1164..1229
FT                   /gene="HLA-DRB1"
FT                   /note="polyA tail: 66 bases do not align to the human
FT                   genome; Differences found between this sequence and the
FT                   human reference genome (build 35) are described in
FT                   misc_difference features below"
XX
SQ   Sequence 1229 BP; 311 A; 313 C; 332 G; 273 T; 0 other;
     cttgcctgct tctctggccc ctggtcctgt cctgttctcc agcatggtgt gtctgaagct        60
     ccctggaggc tcctgcatga cagcgctgac agtgacactg atggtgctga gctccccact       120
     ggctttgtct ggggacaccc gaccacgttt cctgtggcag cctaagaggg agtgtcattt       180
     cttcaatggg acggagcggg tgcggttcct ggacagatac ttctataacc aggaggagtc       240
     cgtgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga       300
     cgctgagtac tggaacagcc agaaggacat cctggagcag gcgcgggccg cggtggacac       360
     ctactgcaga cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccaacc       420
     taaggtgact gtatatcctt caaagaccca gcccctgcag caccacaacc tcctggtctg       480
     ctctgtgagt ggtttctatc caggcagcat tgaagtcagg tggttcctga acggccagga       540
     agagaaggct gggatggtgt ccacaggcct gatccagaat ggagactgga ccttccagac       600
     cctggtgatg ctggaaacag ttcctcgaag tggagaggtt tacacctgcc aagtggagca       660
     cccaagcgtg acaagccctc tcacagtgga atggagagca cggtctgaat ctgcacagag       720
     caagatgctg agtggagtcg ggggctttgt gctgggcctg ctcttccttg gggccgggct       780
     gttcatctac ttcaggaatc agaaaggaca ctctggactt cagccaacag gattcctgag       840
     ctgaaatgca gatgaccaca ttcaaggaag aactttctgc cccggctttg caggatgaaa       900
     agctttcctg cttggcagtt attcttccac aagagagggc tttctcagga cctggttgct       960
     actggttcgg caactgcaga aaatgtcctc ccttgtggct tcctcagctc ctgcccttgg      1020
     cctgaagtcc cagcattgat ggcagcgcct catcttcaac ttttgtgctc ccctttgcct      1080
     aaaccgtatg gcctcccgtg catctgtatt caccctgtat gacaaacaca ttacattatt      1140
     aaatgtttct caaagatgga gttaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1200
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                                        1229
//


spacer
spacer