spacer

EBI Dbfetch

ID   BC033471; SV 1; linear; mRNA; STD; MUS; 3651 BP.
XX
AC   BC033471;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone MGC:37176 IMAGE:4954119), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3651
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3651
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f3361ca12f55591d8b26716c78add9ac.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 60 Row: o Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21450276.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3651
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:37176 IMAGE:4954119"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3651
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   misc_difference 1..4
FT                   /gene="Atp1a1"
FT                   /note="4 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             234..3305
FT                   /codon_start=1
FT                   /gene="Atp1a1"
FT                   /product="ATPase, Na+/K+ transporting, alpha 1 polypeptide"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /protein_id="AAH33471.1"
FT                   /translation="MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHK
FT                   LSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLL
FT                   WIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKN
FT                   MVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGES
FT                   EPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQ
FT                   TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATV
FT                   TVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE
FT                   ADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLK
FT                   CIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDR
FT                   CSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDV
FT                   NFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_difference 3639..3651
FT                   /gene="Atp1a1"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3651 BP; 857 A; 974 C; 1006 G; 814 T; 0 other;
     gtccgcgcgg agcctcggcg ggaggaggcg gacacgtggc agcggcggca gcagcggcgg        60
     cagcagcggc ggcctcggtc cggggcgccg gccgtcctcc ctctttcctc ccgcggcagc       120
     cctagttccc gcctctcggc tcccccggct ccgctctccc ggccgggagc tgctctcttc       180
     tctttctagt ctccagcaac aggacccggc gcggggcccg cagcgccgcc accatgggga       240
     agggggttgg acgagacaag tatgagcctg ccgctgtatc ggagcatggt gacaaaaagg       300
     gcaaaaaggc caagaaggaa agggatatgg atgagctcaa gaaggaagtg tctatggacg       360
     accataaact cagcctggat gaactccatc gtaaatacgg aacagatttg agccgaggat       420
     taacacctgc aagggccgct gagatcctgg cccgggatgg ccccaacgcc ctcacacccc       480
     ctcccactac tcccgaatgg gtgaaattct gccggcagct ctttggaggc ttttccatgt       540
     tactgtggat cggggccatt ctttgtttcc tggcttatgg catccgaagt gctacagaag       600
     aggaaccgcc aaacgatgat ctgtacctcg gggtggtgct ctctgctgta gtcatcataa       660
     ctggctgttt ctcctattat caagaagcaa aaagctccaa gatcatggaa tccttcaaga       720
     acatggtccc tcagcaagcc cttgtgattc gaaatggaga gaaaatgagc atcaatgcgg       780
     aggatgtcgt cgtcggggat ctggtggagg tgaaaggggg agaccggatc cctgctgatc       840
     ttagaatcat atctgcaaac ggctgcaagg tggataactc ctcactcact ggtgaatcag       900
     aaccccagac tcggtccccg gatttcacaa acgagaaccc cttggagaca aggaacattg       960
     ccttcttctc aaccaactgt gtggaaggaa ccgcacgtgg catcgtcgtg tacactgggg      1020
     accgcaccgt gatgggcagg attgccacgc ttgcctctgg gctagaaggt ggccagaccc      1080
     ccattgctga agagattgag catttcatcc acctcatcac cggggtggcc gtgttcctgg      1140
     gggtgtcttt cttcatcctt tctctgatcc ttgagtacac ctggctcgag gctgtcatct      1200
     tcctcattgg tatcatcgta gccaacgtgc cagaaggtct gctggccact gtcacggtct      1260
     gtctgacact cactgccaag cgcatggcga ggaagaactg cctggtgaag aacttggaag      1320
     ctgtggagac cttggggtcc acatctacca tctgctcaga caagacggga actctgactc      1380
     agaaccggat gacagtggcc cacatgtggt ttgacaatca gatccatgaa gctgacacca      1440
     cggagaatca gagtggtgtc tcctttgaca agacgtcagc cacctggttc gctctgtcca      1500
     gaattgctgg tctctgtaac agggcagtgt ttcaggctaa ccaagaaaac ctgcctattc      1560
     ttaagcgggc agtagcggga gatgcctctg agtcggcgct cttaaagtgc attgaagtct      1620
     gctgcggctc cgtgatggag atgagggaga aatacagcaa gatagtggag attcccttca      1680
     actccaccaa caagtaccag ttgtccattc acaagaaccc aaatgcatct gagcccaaac      1740
     acctgctagt gatgaagggc gccccagaaa ggatcctgga ccgctgcagc tccatccttc      1800
     tccacggcaa ggagcagcca ctggatgaag agctgaagga cgcttttcag aacgcctacc      1860
     tagagctggg gggccttgga gaacgtgtgc taggtttctg ccacctcctc ctgcctgacg      1920
     aacagtttcc cgaaggcttc cagtttgaca ctgacgatgt caatttcccc gtggataacc      1980
     tctgcttcgt gggtcttatc tccatgattg accctccccg agctgctgtc cccgatgctg      2040
     tgggcaaatg ccgcagcgct gggattaagg tcatcatggt tacaggagac catccaatca      2100
     cagcgaaagc cattgccaag ggggtaggca ttatctcaga aggcaatgag actgtggaag      2160
     acattgctgc ccgcctcaac attccagtga accaggtgaa ccccagagat gccaaggcct      2220
     gtgtggtcca cggcagtgac ctgaaggaca tgacctccga ggagctggat gacatcttgc      2280
     ggtaccacac agagatcgtc tttgccagga cctctcctca gcagaagctc atcattgtgg      2340
     agggctgcca gcggcagggc gccatcgtgg ccgtcacagg ggatggtgtc aatgactctc      2400
     cagctttgaa aaaggcagat attggggttg ccatggggat tgttggctct gatgtgtcca      2460
     agcaagctgc tgacatgatc cttctggatg acaactttgc ctccattgtg actggagtag      2520
     aggaaggtcg tctgattttt gataacttga agaaatccat cgcttacacc ctaaccagta      2580
     acattccgga aatcaccccc ttcttgatat ttattattgc aaacattcca ctgcccctgg      2640
     ggactgtgac catcctctgc attgacttgg gcactgacat ggttcctgcc atctccctgg      2700
     cctacgagca agctgagagc gacatcatga agaggcagcc cagaaacccc aaaacggaca      2760
     aacttgtgaa cgagcgtctg atcagcatgg cctatggaca gatcggtatg atccaggccc      2820
     tgggaggctt cttcacttac tttgtgattc tggctgagaa cggtttcctg ccctttcacc      2880
     tgttgggcat ccgagagacc tgggatgacc gctgggtcaa cgatgtggag gacagctacg      2940
     ggcagcagtg gacctacgag cagaggaaga tcgtggagtt cacctgccat acagcgttct      3000
     ttgtcagtat tgtggtagtg cagtgggccg acttggtcat ctgcaagacc agaaggaatt      3060
     ctgtcttcca gcagggaatg aagaacaaga tcttgatatt tggcctcttt gaagagacag      3120
     cccttgctgc tttcttatcc tactgccccg ggatgggggc agcccttagg atgtatcccc      3180
     tcaaacctac atggtggttc tgtgccttcc cctactccct tctcatcttt gtgtatgacg      3240
     aggtgcggaa gctcattatc aggcggcgcc ctggcggctg ggtggagaag gaaacctact      3300
     actagcccac tgccctgcac gccgtggaac attgtgccac acactgcacc cacccctacc      3360
     ccctctttgt gtacttcaag tcttggagct cggaactcta ccctggtagg aaagcaccaa      3420
     agcatgtggg gatgcagacg tcctggaatg aagcatgtag ctgtaacggg gggcggggcg      3480
     ggggggaggg ctgcctgaga aacaccgtgt acggggacga cagcgggcaa ggtttatacg      3540
     tgcctttttg tttttgtaaa aaaggaaaac ctggaaagac tgaaagatta cgttttatat      3600
     ctggattttt acaaataaag atggctatta taacggaaaa aaaaaaaaaa a               3651
//


spacer
spacer