spacer

EBI Dbfetch

ID   BC033435; SV 1; linear; mRNA; STD; MUS; 3608 BP.
XX
AC   BC033435;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone MGC:37056 IMAGE:4950746), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3608
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3608
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 60 Row: i Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21450276.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3608
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:37056 IMAGE:4950746"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3608
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   CDS             190..3261
FT                   /codon_start=1
FT                   /gene="Atp1a1"
FT                   /product="ATPase, Na+/K+ transporting, alpha 1 polypeptide"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDN2"
FT                   /protein_id="AAH33435.1"
FT                   /translation="MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHK
FT                   LSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLL
FT                   WIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKN
FT                   MVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGES
FT                   EPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQ
FT                   TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATV
FT                   TVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE
FT                   ADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLK
FT                   CIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDR
FT                   CSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDV
FT                   NFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_difference 3595..3608
FT                   /gene="Atp1a1"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3608 BP; 852 A; 961 C; 984 G; 811 T; 0 other;
     gcggcagcag cggcggcagc agcggcggcc tcggtccggg gcgccggccg tcctccctct        60
     ttcctcccgc ggcagcccta gttcccgcct ctcggctccc ccggctccgc tctcccggcc       120
     gggagctgct ctcttctctt tctagtctcc agcaacagga cccggcgcgg ggcccgcagc       180
     gccgccacca tggggaaggg ggttggacga gacaagtatg agcctgccgc tgtatcggag       240
     catggtgaca aaaagggcaa aaaggccaag aaggaaaggg atatggatga gctcaagaag       300
     gaagtgtcta tggacgacca taaactcagc ctggatgaac tccatcgtaa atacggaaca       360
     gatttgagcc gaggattaac acctgcaagg gccgctgaga tcctggcccg ggatggcccc       420
     aacgccctca caccccctcc cactactccc gaatgggtga aattctgccg gcagctcttt       480
     ggaggctttt ccatgttact gtggatcggg gccattcttt gtttcctggc ttatggcatc       540
     cgaagtgcta cagaagagga accgccaaac gatgatctgt acctcggggt ggtgctctct       600
     gctgtagtca tcataactgg ctgtttctcc tattatcaag aagcaaaaag ctccaagatc       660
     atggaatcct tcaagaacat ggtccctcag caagcccttg tgattcgaaa tggagagaaa       720
     atgagcatca atgcggagga tgtcgtcgtc ggggatctgg tggaggtgaa agggggagac       780
     cggatccctg ctgatcttag aatcatatct gcaaacggct gcaaggtgga taactcctca       840
     ctcactggtg aatcagaacc ccagactcgg tccccggatt tcacaaacga gaaccccttg       900
     gagacaagga acattgcctt cttctcaacc aactgtgtgg aaggaaccgc acgtggcatc       960
     gtcgtgtaca ctggggaccg caccgtgatg ggcaggattg ccacgcttgc ctctgggcta      1020
     gaaggtggcc agacccccat tgctgaagag attgagcatt tcatccacct catcaccggg      1080
     gtggccgtgt tcctgggggt gtctttcttc atcctttctc tgatccttga gtacacctgg      1140
     ctcgaggctg tcatcttcct cattggtatc atcgtagcca acgtgccaga aggtctgctg      1200
     gccactgtca cggtctgtct gacactcact gccaagcgca tggcgaggaa gaactgcctg      1260
     gtgaagaact tggaagctgt ggagaccttg gggtccacat ctaccatctg ctcagacaag      1320
     acgggaactc tgactcagaa ccggatgaca gtggcccaca tgtggtttga caatcagatc      1380
     catgaagctg acaccacgga gaatcagagt ggtgtctcct ttgacaagac gtcagccacc      1440
     tggttcgctc tgtccagaat tgctggtctc tgtaacaggg cagtgtttca ggctaaccaa      1500
     gaaaacctgc ctattcttaa gcgggcagta gcgggagatg cctctgagtc ggcgctctta      1560
     aagtgcattg aagtctgctg cggctccgtg atggagatga gggagaaata cagcaagata      1620
     gtggagattc ccttcaactc caccaacaag taccagttgt ccattcacaa gaacccaaat      1680
     gcatctgagc ccaaacacct gctagtgatg aagggcgccc cagaaaggat cctggaccgc      1740
     tgcagctcca tccttctcca cggcaaggag cagccactgg atgaagagct gaaggacgct      1800
     tttcagaacg cctacctaga gctggggggc cttggagaac gtgtgctagg tttctgccac      1860
     ctcctcctgc ctgacgaaca gtttcccgaa ggcttccagt ttgacactga cgatgtcaat      1920
     ttccccgtgg ataacctctg cttcgtgggt cttatctcca tgattgaccc tccccgagct      1980
     gctgtccccg atgctgtggg caaatgccgc agcgctggga ttaaggtcat catggttaca      2040
     ggagaccatc caatcacagc gaaagccatt gccaaggggg taggcattat ctcagaaggc      2100
     aatgagactg tggaagacat tgctgcccgc ctcaacattc cagtgaacca ggtgaacccc      2160
     agagatgcca aggcctgtgt ggtccacggc agtgacctga aggacatgac ctccgaggag      2220
     ctggatgaca tcttgcggta ccacacagag atcgtctttg ccaggacctc tcctcagcag      2280
     aagctcatca ttgtggaggg ctgccagcgg cagggcgcca tcgtggccgt cacaggggat      2340
     ggtgtcaatg actctccagc tttgaaaaag gcagatattg gggttgccat ggggattgtt      2400
     ggctctgatg tgtccaagca agctgctgac atgatccttc tggatgacaa ctttgcctcc      2460
     attgtgactg gagtagagga aggtcgtctg atttttgata acttgaagaa atccatcgct      2520
     tacaccctaa ccagtaacat tccggaaatc acccccttct tgatatttat tattgcaaac      2580
     attccactgc ccctggggac tgtgaccatc ctctgcattg acttgggcac tgacatggtt      2640
     cctgccatct ccctggccta cgagcaagct gagagcgaca tcatgaagag gcagcccaga      2700
     aaccccaaaa cggacaaact tgtgaacgag cgtctgatca gcatggccta tggacagatc      2760
     ggtatgatcc aggccctggg aggcttcttc acttactttg tgattctggc tgagaacggt      2820
     ttcctgccct ttcacctgtt gggcatccga gagacctggg atgaccgctg ggtcaacgat      2880
     gtggaggaca gctacgggca gcagtggacc tacgagcaga ggaagatcgt ggagttcacc      2940
     tgccatacag cgttctttgt cagtattgtg gtagtgcagt gggccgactt ggtcatctgc      3000
     aagaccagaa ggaattctgt cttccagcag ggaatgaaga acaagatctt gatatttggc      3060
     ctctttgaag agacagccct tgctgctttc ttatcctact gccccgggat gggggcagcc      3120
     cttaggatgt atcccctcaa acctacatgg tggttctgtg ccttccccta ctcccttctc      3180
     atctttgtgt atgacgaggt gcggaagctc attatcaggc ggcgccctgg cggctgggtg      3240
     gagaaggaaa cctactacta gcccactgcc ctgcacgccg tggaacattg tgccacacac      3300
     tgcacccacc cctaccccct ctttgtgtac ttcaagtctt ggagctcgga actctaccct      3360
     ggtaggaaag caccaaagca tgtggggatg cagacgtcct ggaatgaagc atgtagctgt      3420
     aacggggggc ggggcggggg ggagggctgc ctgagaaaca ccgtgtacgg ggacgacagc      3480
     gggcaaggtt tatacgtgcc tttttgtttt tgtaaaaaag gaaaacctgg aaagactgaa      3540
     agattacgtt ttatatctgg atttttacaa ataaagatgg ctattataac ggaaaaaaaa      3600
     aaaaaaaa                                                               3608
//


spacer
spacer