spacer

EBI Dbfetch

ID   BC033394; SV 1; linear; mRNA; STD; MUS; 2872 BP.
XX
AC   BC033394;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus glycoprotein m6a, mRNA (cDNA clone MGC:39028 IMAGE:5364685),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2872
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2872
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bfe6fd585c50d54429209897015c8ddf.
DR   Ensembl-Gn; ENSMUSG00000031517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033915; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 53 Row: h Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981997.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2872
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:39028 IMAGE:5364685"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2872
FT                   /gene="Gpm6a"
FT                   /note="synonyms: MGC38999, M6A"
FT   CDS             79..915
FT                   /codon_start=1
FT                   /gene="Gpm6a"
FT                   /product="glycoprotein m6a"
FT                   /db_xref="GOA:P35802"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35802"
FT                   /protein_id="AAH33394.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
FT   misc_difference 2859..2872
FT                   /gene="Gpm6a"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2872 BP; 802 A; 505 C; 578 G; 987 T; 0 other;
     aaaggcacac gcttttttga catctaattg agcttttgac taataccgtg cgccagattc        60
     tcctgaagaa aggtagccat ggaagagaat atggaagaag gacagacaca gaaagggtgc       120
     ttcgagtgct gcattaaatg cctgggaggt attccctatg cttctctgat tgcaaccatc       180
     ctgctgtatg caggcgttgc cctgttctgt ggctgtggcc atgaagccct ttctggaaca       240
     gtcaacattc tgcagaccta ctttgagttg gcaaggactg ctggagacac actggatgtt       300
     ttcactatga ttgacatctt taagtatgtg atctatggca ttgcggctgc tttctttgtc       360
     tatggcattt tactgatggt agaaggtttc ttcacaactg gggctatcaa agatctctat       420
     ggagacttca aaatcaccac ctgtggcaga tgtgtgagcg cttggtttat catgctgaca       480
     tacctcttca tgttggcctg gctgggagtc acagctttca cctcactgcc cgtgtacatg       540
     tatttcaatg tgtggaccat ctgccggaac accactctag tggagggagc aaatctctgc       600
     ttggatctgc gtcagtttgg gattgtgaca attggagagg aaaagaaaat ttgtactgcc       660
     tctgagaact tcctgaggat gtgtgaatct actgagctga atatgacctt ccacttgttc       720
     attgtggcac ttgctggagc tggagcagca gttattgcta tggtccacta cctgatggtt       780
     ctgtctgcca actgggccta tgtgaaagat gcctgccgca tgcagaagta cgaagacatc       840
     aagtcaaagg aagagcagga gctgcacgac atccattcta ctcgctccaa agagcggctc       900
     aatgcgtaca cataaatacg cttctctgtt ccttaccact cgaaggcatt ggtgtttcat       960
     taagggccat ccaaccatcc aacctgtgaa gagcaaaacg agaatgctac tcatcaaaga      1020
     tgcgcagggt gactaatgaa tcacctgagt ataactcttt gctgttgagc attccatctt      1080
     ctaatttgtt aaattggaat gaccaaatct cctctacaag ctcctattca gtcttttttt      1140
     ttaacctctc aaattgattt agttcttctg tatgatcaaa gatattaaca ttgtccaacg      1200
     caaatctttg tttgattttt aatcacctcc cacatatcac acataacact ttttgcattg      1260
     tttcttatgt tttggaagag aaaatagctt tttttatact ttttagtttt gatttcagta      1320
     actagtttaa ctacaggtaa ccttcaaagg gaccgttgta cattatgaaa gagagacaga      1380
     gatggtatca tgatgactcc gcttgatatg ggaatcagtc tggagagatc agtggccaca      1440
     cggctatcgg ccatggttaa tgttttcatc catctaaggt gcaatttcaa aatttctaag      1500
     ggtaggttaa aaaaaagtgc ttcttatctt tgttaacatt gtattctttt ttcttgatgt      1560
     tcgtaaaagg tatttctctg attactcatg tttatgttgt gagcatgtag aaacagtaat      1620
     gctaatgcat ggccagttgc cttcctaaga ttgtgacacc aggcttacct tttcaagttt      1680
     agtatagaaa caattatcat ggaaataact actgtggact gttggagagt gatctttttt      1740
     tgtgatttat gcagtggctg gattggatct tttaatatgc taatgtggaa aattaattac      1800
     ctttatgaag gtggtatctt aaacataagc acactaaacc ctcaagactt gttttaccca      1860
     cttaaaactt ttaacggatt gcacctctgt aagctatttc ttaaaatgtg tatgatatat      1920
     ttgaaaagac ttccattaat ataatagctt tgcttgcagc cttccaatct atgttggttt      1980
     acctgtagtg tttctaaagg gtggtcagag gccactagag aatgtattgt ttgggagtgt      2040
     agtgatatat attttgtgtt tttatttcaa gtaagtcatt ttaaccaaat gttcattcac      2100
     attcatttat aagaagtacc tatatcagac aaattttaaa agaaaaacaa tcagtattaa      2160
     tggaccaaat ttcgtgtttg ttttaacctt gactctcttt tgattctttc taatgctaca      2220
     agaatgctgt gaaatgtcat ttaaaataat gatgtagcct gacaagaaat tttgtcagtg      2280
     tataaaccta ggtagtattg tgcactgatt tgaccattgt gaattcctcc ttcagtgtaa      2340
     gtgcattccc aataaaattt attgagtgaa acaatctttg tacaactact agtcatgcat      2400
     catcagtaat tttacaagtt cttgtagtag gtagggggta ttactagcgt ttctgtggca      2460
     tgattatgca ttctgtaata ttaatttggg ggtccttttg ctttttaaca cttagattat      2520
     cttaatggtt caacattttt ctgatatatg cagtattaaa gatattgagc aaaagtatta      2580
     atgggcttct ttaaattcta tattatagtg tttcagttct gtgtctacag tgtgtgatga      2640
     tttttaaaac tgtcttttaa atttatgtaa tgatgttgac attttgactt ttatttctgg      2700
     ttttagagtt tgtattttca tggagtgctt tgtagcaggc attacaagta atctgttttg      2760
     tacataaatg tgccaacagc ttgatggtgg cgtttttgaa atgtagaaca aagtgcttgc      2820
     aaaatgtaat aaatacactt gtgtactttg tgtacttaaa aaaaaaaaaa aa              2872
//


spacer
spacer