spacer

EBI Dbfetch

ID   BC033377; SV 1; linear; mRNA; STD; MUS; 1575 BP.
XX
AC   BC033377;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus serine (or cysteine) peptidase inhibitor, clade C
DE   (antithrombin), member 1, mRNA (cDNA clone MGC:29925 IMAGE:5123932),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1575
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1575
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7711b9e944f81dc59479ff6609832523.
DR   Ensembl-Gn; ENSMUSG00000026715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064725; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 42 Row: p Column: 19.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1575
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:29925 IMAGE:5123932"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1575
FT                   /gene="Serpinc1"
FT                   /note="synonym: ATIII"
FT   CDS             57..1454
FT                   /codon_start=1
FT                   /gene="Serpinc1"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade C
FT                   (antithrombin), member 1"
FT                   /db_xref="GOA:P32261"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR015555"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:88095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32261"
FT                   /protein_id="AAH33377.1"
FT                   /translation="MYSPGAGSGAAGERKLCLLSLLLIGALGCAICHGNPVDDICIAKP
FT                   RDIPVNPLCIYRSPGKKATEEDGSEQKVPEATNRRVWELSKANSRFATNFYQHLADSKN
FT                   DNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRL
FT                   YRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNW
FT                   VANKTEGRIKDVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKVDGQSCP
FT                   VPMMYQEGKFKYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEW
FT                   LDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSD
FT                   AFHKAFLEVNEEGSEAAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGR
FT                   VANPCVN"
FT   misc_difference 1532..1575
FT                   /gene="Serpinc1"
FT                   /note="polyA tail: 44 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1575 BP; 430 A; 411 C; 385 G; 349 T; 0 other;
     aaccagtttt cggagtgatc gtctcagtca gcaccatctc tgtaggagca tcggccatgt        60
     attcccctgg ggcaggaagt ggggctgctg gtgagaggaa gctttgtctc ctctctctgc       120
     tcctcatcgg tgccttgggc tgtgctatct gtcacggaaa ccctgtggac gacatctgca       180
     tagcgaagcc ccgagacatc cccgtgaatc ccttgtgcat ttaccgctcc cctgggaaga       240
     aggccaccga ggaggatggc tcagagcaga aggttccaga agccaccaac cggcgggtct       300
     gggaactgtc caaggccaat tcgcgatttg ccactaactt ctaccagcac ctggcagact       360
     ccaagaatga caacgacaac attttcctgt cacccttgag catctccact gcttttgcta       420
     tgaccaagct gggtgcctgt aacgacactc tcaagcagct gatggaggtt tttaaatttg       480
     ataccatctc cgagaagaca tccgaccaga tccacttctt ctttgccaaa ctgaactgcc       540
     gactctatcg aaaagccaac aagtcctctg acttggtatc agccaaccgc ctttttggag       600
     acaaatccct caccttcaac gagagctatc aagatgttag tgaggttgtc tatggagcca       660
     agctccagcc cctggacttc aaggagaatc cggagcaatc cagagtgacc atcaacaact       720
     gggtagctaa taagactgaa ggccgcatca aagatgtcat cccacagggc gccattaacg       780
     agctcactgc cctggttctg gttaacacca tttacttcaa gggcctgtgg aagtcaaagt       840
     tcagccctga gaacacaagg aaggaaccgt tctataaggt cgatgggcag tcatgcccag       900
     tgcctatgat gtaccaggaa ggcaaattca aataccggcg cgtggcagag ggcacccagg       960
     tgctagagct gcccttcaag ggggatgaca tcaccatggt gctcatcctg cccaagcctg      1020
     agaagagcct ggccaaggtg gagcaggagc tcaccccaga gctgctgcag gagtggctgg      1080
     atgagctgtc agagactatg cttgtggtcc acatgccccg cttccgcacc gaggatggct      1140
     tcagtctgaa ggagcagctg caagacatgg gcctcattga tctcttcagc cctgaaaagt      1200
     cccaactccc agggatcgtt gctggaggca gggacgacct ctatgtctcc gacgcattcc      1260
     acaaagcatt tcttgaggta aatgaggaag gcagtgaagc agcagcgagt acttctgtcg      1320
     tgattactgg ccggtcactg aaccccaata gggtgacctt caaggccaac aggcccttcc      1380
     tggttcttat aagggaagtt gcactgaaca ctattatatt catggggaga gtggctaatc      1440
     cttgtgtgaa ctaaaatatt cttaatcttt gcaccttttc ctactttggt gtttgtgaat      1500
     agaagtaaaa ataaatacga ctgccacctc aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1560
     aaaaaaaaaa aaaaa                                                       1575
//


spacer
spacer