spacer

EBI Dbfetch

ID   BC033357; SV 1; linear; mRNA; STD; MUS; 2920 BP.
XX
AC   BC033357;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus glycoprotein m6a, mRNA (cDNA clone MGC:38979 IMAGE:5363493),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2920
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2920
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7213d5cda85687fd75510835e9a917ad.
DR   Ensembl-Gn; ENSMUSG00000031517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033915; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 53 Row: e Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981997.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2920
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:38979 IMAGE:5363493"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2920
FT                   /gene="Gpm6a"
FT                   /note="synonyms: MGC38999, M6A"
FT   CDS             121..957
FT                   /codon_start=1
FT                   /gene="Gpm6a"
FT                   /product="glycoprotein m6a"
FT                   /db_xref="GOA:P35802"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35802"
FT                   /protein_id="AAH33357.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
FT   misc_difference 2907..2920
FT                   /gene="Gpm6a"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2920 BP; 813 A; 519 C; 591 G; 997 T; 0 other;
     aggacttgcc caagccactg ctgctggagc tgcccaggga aaaaaggcac acgctttttt        60
     gacatctaat tgagcttttg actaataccg tgcgccagat tctcctgaag aaaggtagcc       120
     atggaagaga atatggaaga aggacagaca cagaaagggt gcttcgagtg ctgcattaaa       180
     tgcctgggag gtattcccta tgcttctctg attgcaacca tcctgctgta tgcaggcgtt       240
     gccctgttct gtggctgtgg ccatgaagcc ctttctggaa cagtcaacat tctgcagacc       300
     tactttgagt tggcaaggac tgctggagac acactggatg ttttcactat gattgacatc       360
     tttaagtatg tgatctatgg cattgcggct gctttctttg tctatggcat tttactgatg       420
     gtagaaggtt tcttcacaac tggggctatc aaagatctct atggagactt caaaatcacc       480
     acctgtggca gatgtgtgag cgcttggttt atcatgctga catacctctt catgttggcc       540
     tggctgggag tcacagcttt cacctcactg cccgtgtaca tgtatttcaa tgtgtggacc       600
     atctgccgga acaccactct agtggaggga gcaaatctct gcttggatct gcgtcagttt       660
     gggattgtga caattggaga ggaaaagaaa atttgtactg cctctgagaa cttcctgagg       720
     atgtgtgaat ctactgagct gaatatgacc ttccacttgt tcattgtggc acttgctgga       780
     gctggagcag cagttattgc tatggtccac tacctgatgg ttctgtctgc caactgggcc       840
     tatgtgaaag atgcctgccg catgcagaag tacgaagaca tcaagtcaaa ggaagagcag       900
     gagctgcacg acatccattc tactcgctcc aaagagcggc tcaatgcgta cacataaata       960
     cgcttctctg ttccttacca ctcgaaggca ttggtgtttc attaagggcc atccaaccat      1020
     ccaacctgtg aagagcaaaa cgagaatgct actcatcaaa gatgcgcagg gtgactaatg      1080
     aatcacctga gtataactct ttgctgttga gcattccatc ttctaatttg ttaaattgga      1140
     atgaccaaat ctcctctaca agctcctatt cagtcttttt ttttaacctc tcaaattgat      1200
     ttagttcttc tgtatgatca aagatattaa cattgtccaa cgcaaatctt tgtttgattt      1260
     ttaatcacct cccacatatc acacataaca ctttttgcat tgtttcttat gttttggaag      1320
     agaaaatagc tttttttata ctttttagtt ttgatttcag taactagttt aactacaggt      1380
     aaccttcaaa gggaccgttg tacattatga aagagagaca gagatggtat catgatgact      1440
     ccgcttgata tgggaatcag tctggagaga tcagtggcca cacggctatc ggccatggtt      1500
     aatgttttca tccatctaag gtgcaatttc aaaatttcta agggtaggtt aaaaaaaagt      1560
     gcttcttatc tttgttaaca ttgtattctt ttttcttgat gttcgtaaaa ggtatttctc      1620
     tgattactca tgtttatgtt gtgagcatgt agaaacagta atgctaatgc atggccagtt      1680
     gccttcctaa gattgtgaca ccaggcttac cttttcaagt ttagtataga aacaattatc      1740
     atggaaataa ctactgtgga ctgttggaga gtgatctttt tttgtgattt atgcagtggc      1800
     tggattggat cttttaatat gctaatgtgg aaaattaatt acctttatga aggtggtatc      1860
     ttaaacataa gcacactaaa ccctcaagac ttgttttacc cacttaaaac ttttaacgga      1920
     ttgcacctct gtaagctatt tcttaaaatg tgtatgatat atttgaaaag acttccatta      1980
     atataatagc tttgcttgca gccttccaat ctatgttggt ttacctgtag tgtttctaaa      2040
     gggtggtcag aggccactag agaatgtatt gtttgggagt gtagtgatat atattttgtg      2100
     tttttatttc aagtaagtca ttttaaccaa atgttcattc acattcattt ataagaagta      2160
     cctatatcag acaaatttta aaagaaaaac aatcagtatt aatggaccaa atttcgtgtt      2220
     tgttttaacc ttgactctct tttgattctt tctaatgcta caagaatgct gtgaaatgtc      2280
     atttaaaata atgatgtagc ctgacaagaa attttgtcag tgtataaacc taggtagtat      2340
     tgtgcactga tttgaccatt gtgaattcct ccttcagtgt aagtgcattc ccaataaaat      2400
     ttattgagtg aaacaatctt tgtacaacta ctagtcatgc atcatcagta attttacaag      2460
     ttcttgtagt aggtaggggg tattactagc gtttctgtgg catgattatg cattctgtaa      2520
     tattaatttg ggggtccttt tgctttttaa cacttagatt atcttaatgg ttcaacattt      2580
     ttctgatata tgcagtatta aagatattga gcaaaagtat taatgggctt ctttaaattc      2640
     tatattatag tgtttcagtt ctgtgtctac agtgtgtgat gatttttaaa actgtctttt      2700
     aaatttatgt aatgatgttg acattttgac ttttatttct ggttttagag tttgtatttt      2760
     catggagtgc tttgtagcag gcattacaag taatctgttt tgtacataaa tgtgccaaca      2820
     gcttgatggt ggcgtttttg aaatgtagaa caaagtgctt gcaaaatgta ataaatacac      2880
     ttgtgtactt tgtgtactta ttcttaaaaa aaaaaaaaaa                            2920
//


spacer
spacer