spacer

EBI Dbfetch

ID   BC032883; SV 1; linear; mRNA; STD; MUS; 2173 BP.
XX
AC   BC032883;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 14)
XX
DE   Mus musculus adrenergic receptor, beta 2, mRNA (cDNA clone MGC:41462
DE   IMAGE:1349283), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2173
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2173
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 43454a7ad633605d3390edfce4e99b37.
DR   Ensembl-Gn; ENSMUSG00000045730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053640; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Marcello Bento Soares, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 66 Row: p Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328091.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2173
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Soares_mammary_gland_NbMMG"
FT                   /clone="MGC:41462 IMAGE:1349283"
FT                   /tissue_type="Mammary gland"
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..2173
FT                   /gene="Adrb2"
FT   CDS             208..1464
FT                   /codon_start=1
FT                   /gene="Adrb2"
FT                   /product="adrenergic receptor, beta 2"
FT                   /db_xref="GOA:P18762"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000332"
FT                   /db_xref="InterPro:IPR002233"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:87938"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18762"
FT                   /protein_id="AAH32883.1"
FT                   /translation="MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVL
FT                   AIVFGNVLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNF
FT                   WCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGL
FT                   TSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRV
FT                   FQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGT
FT                   FTLCWLPFFIVNIVHVIRDNLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELL
FT                   CLRRSSSKTYGNGYSSNSNGRTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTV
FT                   PSLSVDSQGRNCSTNDSPL"
FT   misc_difference 2145..2173
FT                   /gene="Adrb2"
FT                   /note="polyA tail: 29 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2173 BP; 504 A; 519 C; 531 G; 619 T; 0 other;
     caggcattca ggctgcggct gcaggcaccg cgagcccgga gcacccacga gctgagtgtg        60
     caggacgcac cccagcacag ccacctacgg ccgctgaatg aagcttccag gagtccgccc       120
     ccggccggct gcgccccgtc ggaggtgcac ccgctgagag cgcctgggca ccgaaagccg       180
     gtgcgctcac ctgctaacct gccagccatg gggccacacg ggaacgacag cgacttcttg       240
     ctggcaccca acggaagccg agcgccagac cacgacgtca ctcaggaacg ggacgaagcg       300
     tgggttgtgg gcatggccat cctcatgtcg gttatcgtcc tggccatcgt gtttggcaac       360
     gtgctggtca tcacagccat tgccaagttc gagcgactac aaaccgtcac caactacttc       420
     ataatctcct tggcgtgtgc tgatctagtc atgggcctag cggtggtgcc gtttggggcc       480
     agtcacatcc ttatgaaaat gtggaatttt ggcaacttct ggtgcgagtt ctggacttcc       540
     attgatgtgt tgtgcgtcac agccagcatc gagaccctgt gcgtgattgc agtggatcgc       600
     tatgttgcta tcacatcgcc cttcaagtac cagagcctgc tgaccaagaa taaggcccga       660
     gtggtcatcc tgatggtatg gattgtatct ggccttacct cctttttgcc tatccagatg       720
     cactggtacc gtgccaccca caagaaagct atcgattgtt acaccgagga gacttgctgt       780
     gacttcttca cgaaccaggc ctacgccatc gcgtcctcga ttgtgtcttt ctacgtgccc       840
     ctggtggtga tggtctttgt ctattcccgg gtcttccagg tggccaaaag gcagctgcag       900
     aagatagaca aatctgaagg aagattccac gcccaaaacc tcagccaggt ggagcaggat       960
     gggcggagcg gccacggact ccgaaggtcc tccaagttct gcttgaaaga gcacaaagcc      1020
     ctcaagactt taggcatcat catgggcaca ttcaccctct gctggctgcc cttcttcatt      1080
     gtcaatatcg tgcacgttat cagggacaac ctcatcccta aggaagttta catcctcctt      1140
     aactggttgg gctacgtcaa ctctgccttc aatcctctta tctactgtcg gagtccagat      1200
     ttcaggattg cctttcaaga gcttctgtgc cttcgcaggt cttcttcgaa aacctatggg      1260
     aacggctact ctagcaatag caacggcaga acggactaca caggggagcc aaacacttgt      1320
     cagctggggc aggagagaga acaggaactg ctgtgtgagg atcccccagg catggaaggc      1380
     tttgtgaact gtcaaggtac tgtgcctagc cttagcgttg actcccaagg aaggaactgt      1440
     agtacaaatg actcgccact gtaatacagg ctttctactc tctaagaccc ctccttgaca      1500
     ggacactaac cagactattt aacttgagtg taataacttt agaataaaat tgtatagaga      1560
     tttgcagaag gggaggcaca tccttctgcc tttttttaaa ttttatttta ttttttaagc      1620
     tgcaaacaag agagagaaac tgtatttgag tgcttattgt tttcttgtat agttcagttc      1680
     ctctttgtat ggaacttaaa ggtttctgtc tgaagagtgt tggttctgga ggactgagtc      1740
     tgtctgtctg tctgtctgga tgatgttttc atgtatctac ctcactggtc aagtattaag      1800
     aatgatatat attgctgctg gaaatccata tctaaaggag agagttttct tcctgtaccc      1860
     ttggacttga aatatcctgt gtcttggacc tttctgctgt gacaatgggc cctttctctc      1920
     tcactccact tatttactca aatggagtgt tgcaggcagg gatttgaggg acaacatcag      1980
     ttgttttgtt tttgtttttg tttttgtttt tttgtttgtt tggttcgttt ttggtttgtt      2040
     gttgtttttt ggggttttgt ttttgttttt gtttttttgg gttttttttt tttttttgct      2100
     gagaaaagtc taaagtttac agtaaataaa ttgtttaacc atgaaaaaaa aaaaaaaaaa      2160
     aaaaaaaaaa aaa                                                         2173
//


spacer
spacer