spacer

EBI Dbfetch

ID   BC032278; SV 1; linear; mRNA; STD; MUS; 1567 BP.
XX
AC   BC032278;
XX
DT   28-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus Fas apoptotic inhibitory molecule 2, mRNA (cDNA clone
DE   MGC:40667 IMAGE:5400222), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1567
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1567
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 719d33c6e4a8e11ffa868848b54beeb8.
DR   Ensembl-Gn; ENSMUSG00000023011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023750; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 65 Row: n Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 35) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1567
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:40667 IMAGE:5400222"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1567
FT                   /gene="Faim2"
FT                   /note="synonyms: Lfg, NMP25, mKIAA0950, lifeguard"
FT   misc_difference 1..11
FT                   /gene="Faim2"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             86..1039
FT                   /codon_start=1
FT                   /gene="Faim2"
FT                   /product="Faim2 protein"
FT                   /db_xref="GOA:Q8K097"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1919643"
FT                   /protein_id="AAH32278.1"
FT                   /translation="MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSG
FT                   EGLKAGTFPQGPTAVPLHPSWAYVDPSGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFI
FT                   RKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPR
FT                   RHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFT
FT                   SCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNR
FT                   RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE"
FT   misc_difference 1411
FT                   /gene="Faim2"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1414
FT                   /gene="Faim2"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1416..1567
FT                   /gene="Faim2"
FT                   /note="152 bases at the 3' end do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1567 BP; 376 A; 473 C; 369 G; 349 T; 0 other;
     ccacgcgtcc gagagacgca ggcaggctgc ggtgacccaa gcggccaccc ccgcttcagg        60
     gaccccttcc tcgagagaag acatcatgac ccagggaaag ctctctgtgg ctaacaaggc       120
     ccccgggact gaggggcagc agcaccaggc aaatggagag aagaaggatg ctccggcagt       180
     gccctcggcg ccaccctcct atgaggaggc cacctctgga gaggggctga aggcagggac       240
     cttcccccag ggcccaacag ctgtgccact ccatccaagc tgggcctacg tggaccccag       300
     cggcagctcc ggctatgaag gtggtttccc cgcaggacat cacgagcatt tcaccacctt       360
     cagctgggat gaccagaaag ttcgtcggct cttcatcaga aaggtctata ccatcctatt       420
     ggtccagctg ctggtgacct tggctgtggt ggctctcttt accttctgtg atgtcgttaa       480
     ggactatgtc caggctaacc ccggctggta ctgggcgtcc tatgccgtgt tctttgcaac       540
     ttacctgact ctggcttgct gttctggacc caggagacat ttcccttgga acctgattct       600
     gctgaccatc tttaccctgt ccatggccta cctcactggg atgctgtcca gttactacaa       660
     caccacatct gtgctgctgt gcctggtcat cacggctctc gtctgcctct cggtcaccat       720
     cttcagtttc cagaccaagt ttgacttcac ctcctgtcag ggtgtgctgt ttgtgctgct       780
     catgaccctc ttcttcagtg gactcctcct cgctgtcctc ctgcccttcc aatacgtccc       840
     ctggctccac gcggtctatg ctgtactggg agcgggtgtg ttcacgttgt tcctggcctt       900
     tgatacccag ttgctgatgg gtaaccgtcg acactcgctg agccccgagg agtatatttt       960
     tggagccctc aacatctact tagacattat ctatatcttc accttcttcc tgcagctttt      1020
     tggcaccaac cgggaatgag gagccatccc cgcccccacc cctcctccag agaatgtccc      1080
     ttccctgtcc tgtgaccctc tccgtgctcc tgtgagacca gacataaact cgctgcagcc      1140
     agcttgtgag cagccgcttg ctccctcctg cagccagccc tcacggtgtc cttctgcagc      1200
     ttgtacatat gccatgcttg gggccctgca gatctgaggc cataccatcc cctgcggtgc      1260
     ccctggcacc caactgcatc ttccaaatgg cacagtcaag gctgagggca cctctgggtt      1320
     tgcagaccca aggaatgagc aggaggagcc cggcaggatc tcagaggtgg ggaggagacc      1380
     ccaggaaacc tggctgtgac tgtgaccccc ccccaacagc tgtactttca gtgacacacg      1440
     gtctgttcct aataaatatt tttttaaata aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1500
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1560
     aaaaaaa                                                                1567
//


spacer
spacer