Dbfetch

ID   BC032187; SV 1; linear; mRNA; STD; MUS; 3733 BP.
XX
AC   BC032187;
XX
DT   27-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone MGC:38145 IMAGE:5321268), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3733
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3733
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d0146235dc6c4d6231b62c11fb4dfdf9.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027676; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027635; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027601; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027648; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027377; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028091; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026833; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027352; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027495; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027463; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027602; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027493; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028146; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026913; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062775; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0062803; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0062734; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062726; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062410; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063220; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062718; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0062375; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0062489; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0062457; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0062624; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062456; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063420; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062255; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061682; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 56 Row: g Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21450276.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3733
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38145 IMAGE:5321268"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3733
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   misc_difference 1..24
FT                   /gene="Atp1a1"
FT                   /note="24 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             294..3365
FT                   /codon_start=1
FT                   /gene="Atp1a1"
FT                   /product="ATPase, Na+/K+ transporting, alpha 1 polypeptide"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDN2"
FT                   /protein_id="AAH32187.1"
FT                   /translation="MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHK
FT                   LSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLL
FT                   WIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKN
FT                   MVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGES
FT                   EPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQ
FT                   TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATV
FT                   TVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE
FT                   ADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLK
FT                   CIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDR
FT                   CSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDV
FT                   NFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_difference 3699..3733
FT                   /gene="Atp1a1"
FT                   /note="polyA tail: 35 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3733 BP; 886 A; 993 C; 1033 G; 821 T; 0 other;
     ccacgcgtcc gcccacgcgt ccggtgagga ggaggcacgg gctcgagctg cggctgggtc        60
     tggggcgcgg agcctcggcg ggaggaggcg gacacgtggc agcggcggca gcagcggcgg       120
     cagcagcggc ggcctcggtc cggggcgccg gccgtcctcc ctctttcctc ccgcggcagc       180
     cctagttccc gcctctcggc tcccccggct ccgctctccc ggccgggagc tgctctcttc       240
     tctttctagt ctccagcaac aggacccggc gcggggcccg cagcgccgcc accatgggga       300
     agggggttgg acgagacaag tatgagcctg ccgctgtatc ggagcatggt gacaaaaagg       360
     gcaaaaaggc caagaaggaa agggatatgg atgagctcaa gaaggaagtg tctatggacg       420
     accataaact cagcctggat gaactccatc gtaaatacgg aacagatttg agccgaggat       480
     taacacctgc aagggccgct gagatcctgg cccgggatgg ccccaacgcc ctcacacccc       540
     ctcccactac tcccgaatgg gtgaaattct gccggcagct ctttggaggc ttttccatgt       600
     tactgtggat cggggccatt ctttgtttcc tggcttatgg catccgaagt gctacagaag       660
     aggaaccgcc aaacgatgat ctgtacctcg gggtggtgct ctctgctgta gtcatcataa       720
     ctggctgttt ctcctattat caagaagcaa aaagctccaa gatcatggaa tccttcaaga       780
     acatggtccc tcagcaagcc cttgtgattc gaaatggaga gaaaatgagc atcaatgcgg       840
     aggatgtcgt cgtcggggat ctggtggagg tgaaaggggg agaccggatc cctgctgatc       900
     ttagaatcat atctgcaaac ggctgcaagg tggataactc ctcactcact ggtgaatcag       960
     aaccccagac tcggtccccg gatttcacaa acgagaaccc cttggagaca aggaacattg      1020
     ccttcttctc aaccaactgt gtggaaggaa ccgcacgtgg catcgtcgtg tacactgggg      1080
     accgcaccgt gatgggcagg attgccacgc ttgcctctgg gctagaaggt ggccagaccc      1140
     ccattgctga agagattgag catttcatcc acctcatcac cggggtggcc gtgttcctgg      1200
     gggtgtcttt cttcatcctt tctctgatcc ttgagtacac ctggctcgag gctgtcatct      1260
     tcctcattgg tatcatcgta gccaacgtgc cagaaggtct gctggccact gtcacggtct      1320
     gtctgacact cactgccaag cgcatggcga ggaagaactg cctggtgaag aacttggaag      1380
     ctgtggagac cttggggtcc acatctacca tctgctcaga caagacggga actctgactc      1440
     agaaccggat gacagtggcc cacatgtggt ttgacaatca gatccatgaa gctgacacca      1500
     cggagaatca gagtggtgtc tcctttgaca agacgtcagc cacctggttc gctctgtcca      1560
     gaattgctgg tctctgtaac agggcagtgt ttcaggctaa ccaagaaaac ctgcctattc      1620
     ttaagcgggc agtagcggga gatgcctctg agtcggcgct cttaaagtgc attgaagtct      1680
     gctgcggctc cgtgatggag atgagggaga aatacagcaa gatagtggag attcccttca      1740
     actccaccaa caagtaccag ttgtccattc acaagaaccc aaatgcatct gagcccaaac      1800
     acctgctagt gatgaagggc gccccagaaa ggatcctgga ccgctgcagc tccatccttc      1860
     tccacggcaa ggagcagcca ctggatgaag agctgaagga cgcttttcag aacgcctacc      1920
     tagagctggg gggccttgga gaacgtgtgc taggtttctg ccacctcctc ctgcctgacg      1980
     aacagtttcc cgaaggcttc cagtttgaca ctgacgatgt caatttcccc gtggataacc      2040
     tctgcttcgt gggtcttatc tccatgattg accctccccg agctgctgtc cccgatgctg      2100
     tgggcaaatg ccgcagcgct gggattaagg tcatcatggt tacaggagac catccaatca      2160
     cagcgaaagc cattgccaag ggggtaggca ttatctcaga aggcaatgag actgtggaag      2220
     acattgctgc ccgcctcaac attccagtga accaggtgaa ccccagagat gccaaggcct      2280
     gtgtggtcca cggcagtgac ctgaaggaca tgacctccga ggagctggat gacatcttgc      2340
     ggtaccacac agagatcgtc tttgccagga cctctcctca gcagaagctc atcattgtgg      2400
     agggctgcca gcggcagggc gccatcgtgg ccgtcacagg ggatggtgtc aatgactctc      2460
     cagctttgaa aaaggcagat attggggttg ccatggggat tgttggctct gatgtgtcca      2520
     agcaagctgc tgacatgatc cttctggatg acaactttgc ctccattgtg actggagtag      2580
     aggaaggtcg tctgattttt gataacttga agaaatccat cgcttacacc ctaaccagta      2640
     acattccgga aatcaccccc ttcttgatat ttattattgc aaacattcca ctgcccctgg      2700
     ggactgtgac catcctctgc attgacttgg gcactgacat ggttcctgcc atctccctgg      2760
     cctacgagca agctgagagc gacatcatga agaggcagcc cagaaacccc aaaacggaca      2820
     aacttgtgaa cgagcgtctg atcagcatgg cctatggaca gatcggtatg atccaggccc      2880
     tgggaggctt cttcacttac tttgtgattc tggctgagaa cggtttcctg ccctttcacc      2940
     tgttgggcat ccgagagacc tgggatgacc gctgggtcaa cgatgtggag gacagctacg      3000
     ggcagcagtg gacctacgag cagaggaaga tcgtggagtt cacctgccat acagcgttct      3060
     ttgtcagtat tgtggtagtg cagtgggccg acttggtcat ctgcaagacc agaaggaatt      3120
     ctgtcttcca gcagggaatg aagaacaaga tcttgatatt tggcctcttt gaagagacag      3180
     cccttgctgc tttcttatcc tactgccccg ggatgggggc agcccttagg atgtatcccc      3240
     tcaaacctac atggtggttc tgtgccttcc cctactccct tctcatcttt gtgtatgacg      3300
     aggtgcggaa gctcattatc aggcggcgcc ctggcggctg ggtggagaag gaaacctact      3360
     actagcccac tgccctgcac gccgtggaac attgtgccac acactgcacc cacccctacc      3420
     ccctctttgt gtacttcaag tcttggagct cggaactcta ccctggtagg aaagcaccaa      3480
     agcatgtggg gatgcagacg tcctggaatg aagcatgtag ctgtaacggg gggcggggcg      3540
     ggggggaggg ctgcctgaga aacaccgtgt acggggacga cagcgggcaa ggtttatacg      3600
     tgcctttttg tttttgtaaa aaaggaaaac ctggaaagac tgaaagatta cgttttatat      3660
     ctggattttt acaaataaag atggctatta taacggaaaa aaaaaaaaaa aaaaaaaaaa      3720
     aaaaaaaaaa aaa                                                         3733
//