spacer

EBI Dbfetch

ID   BC032166; SV 1; linear; mRNA; STD; MUS; 4053 BP.
XX
AC   BC032166;
XX
DT   28-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus myotubularin related protein 3, mRNA (cDNA clone MGC:38509
DE   IMAGE:5352919), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4053
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4053
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1eb2035321e0aef14c044282b4297d2c.
DR   Ensembl-Gn; ENSMUSG00000034354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123506; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: l Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 23346434.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4053
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38509 IMAGE:5352919"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4053
FT                   /gene="Mtmr3"
FT                   /note="synonyms: FYVE-DSP1, ZFYVE10, mKIAA0371"
FT   misc_difference 1..6
FT                   /gene="Mtmr3"
FT                   /note="6 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 9..10
FT                   /gene="Mtmr3"
FT                   /note="in the mouse genome : GT."
FT   misc_difference 162
FT                   /gene="Mtmr3"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   CDS             278..3505
FT                   /codon_start=1
FT                   /gene="Mtmr3"
FT                   /product="myotubularin related protein 3"
FT                   /db_xref="GOA:Q8K296"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1921552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K296"
FT                   /protein_id="AAH32166.1"
FT                   /translation="MDEEMRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYV
FT                   GRAEEAIIALSNYRLHIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFPTF
FT                   EQCQDWLKRLNNAIRPPGKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKN
FT                   EVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVAGFRSWKRIPAVI
FT                   YRHQSNGAVIARCGQPEVSWWGWRNADDEHLVQSVARACASDSQSSISKVSTRNSCRDF
FT                   PNAGDLSDVEFDSSLSNTSGAESLALQPQKLLILDARSYAAAVANRAKGGGCECPEYYP
FT                   NCEVVFMGMANIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVV
FT                   HAVDRDQRPVLVHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFAD
FT                   RCGHGEDSDDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFL
FT                   CNNAKERGEKQTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVY
FT                   LPCPSPSTPTDDSCAPYPVPGTSPDEPPLSRLPKTRSFDNLTTTCENMVPLASRRSSDP
FT                   SLNEKWQEHGRSLELSSFASAGEEVPAMDSLRKPSRLLGGAELSVAAGVAEGQMENILQ
FT                   EATKEESGVEEPTHRGHTEVPEVKEEAPLAKESSMAAEGPVVLYQEPQLDDATLRSHQG
FT                   PSLSLFSQGIPEHQDGHNVLSSSLQAPLSGEDSQEVPVEQPQVENIAEDRENVAPAVPV
FT                   DAKVGLGISQSSSLLPSQVPFETRGPHINNSVHMLLEDKVKSESGPQLHHRPCPASSGR
FT                   FSGKDMLPVAPEPRSAERPQWDSVLHRTSSPGNTLSLLQAPCALPLDKCRQGIVCNGAL
FT                   ETENKASEQPAGFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHH
FT                   KWLNSHSGRPSTTSSPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQ
FT                   ELKSRLESQYLTSSLRFNGDFGDEVVS"
FT   misc_difference 2623
FT                   /gene="Mtmr3"
FT                   /note="'T' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'S' in cDNA, 'R' in the mouse genome."
FT   misc_difference 3970..4053
FT                   /gene="Mtmr3"
FT                   /note="polyA tail: 84 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4053 BP; 1040 A; 1036 C; 1084 G; 893 T; 0 other;
     ccacgcgtcc ggccgctgcc gccatgttgt tgtggttgtg agaaggcggc ggcggcagcg        60
     gcggcggcgg cggcggagca gccggcggag acgctccagc ggcccaggcg ctggcccccg       120
     ccgaccctgg ctggcagcct cctggggtgg cggaggaggc cgtgcggtgg cgggcctcgc       180
     catgtcctgc cgcctgtaaa aggtctcaag cagaagagaa agagtagcct tgtcagagac       240
     tggagaagga cgcagccgct cctgacctgg cctggtcatg gatgaagaga tgcggcatag       300
     ccttgagtgc atccaggcca atcagatctt tcccaggaag cagctgattc gggaggatga       360
     gaatcttcag gttcctttcc ttgaacttca tggagagagc acagagtatg tgggccgtgc       420
     tgaggaggcc atcattgctc tttctaatta caggcttcac atcaagttca aggagtctct       480
     tgtcaatgtt ccattacagc ttattgaaag cgttgaatgc cgtgatatat ttcagcttca       540
     tttgacatgc aaagactgca aagttatcag gtgtcagttc ccaacctttg agcaatgtca       600
     agattggctt aagagattga acaatgcaat ccgaccacct ggtaaaatag aagatctctt       660
     ctcatttgca taccatgctt ggtgcatgga ggtctacgcc agtgaaaagg agcagcatgg       720
     agacctgtgc agaccagggg aacatgtgac gtcaaggttt aagaatgaag tggagcggat       780
     gggttttgat atgaacaatg cctggaggat ttccaacatc aatgagaaat acaaattatg       840
     tggtagttat ccacaagagc tcatagtgcc tgcttggatc actgacaaag agctggaaag       900
     cgtggcaggc ttcagatcct ggaagcgcat ccctgctgtc atctacaggc accagagcaa       960
     tggagctgtc attgcccgct gcggacaacc ggaggttagc tggtggggct ggcgaaatgc      1020
     tgatgatgaa catctggtgc agtcagtggc cagagcctgt gcttctgact ctcagtcaag      1080
     tatcagcaag gtttccactc ggaacagttg tcgggacttt cccaacgcag gggatctttc      1140
     agatgtggag ttcgattcct ctctgtcaaa tacttcagga gcagaaagtt tagctctcca      1200
     gccccagaag cttttgatct tggatgcacg ctcctatgca gcagctgtgg caaatcgagc      1260
     caaaggagga ggctgtgagt gcccagagta ttatcctaac tgtgaagttg tgtttatggg      1320
     aatggcaaac atacattcta tccggaggag tttccagtct ctgcggctgc tgtgcacaca      1380
     gatgccagat cctggaaatt ggctttctgc ccttgaaagt acaaagtggc tccatcacct      1440
     atctgtgctt ctgaagtcgg cacttctcgt ggtgcatgct gtggaccgtg atcagcgacc      1500
     agtgctagtg cactgctccg atggctggga tcggactccc cagattgtgg ccctagctaa      1560
     gctcctactt gacccttatt accgaaccat agagggtttc caagtcctgg tggagatgga      1620
     atggctcgat tttggccata agtttgctga ccggtgtggt catggggagg actcagatga      1680
     tctgaatgag cgctgcccag tgtttctaca atggcttgac tgtgttcatc aacttcagag      1740
     gcagtttcct tgctcttttg agttcaacga agcattcctt gtgaaactgg tacagcatac      1800
     ctattcctgt ctctttggaa cattcctgtg caacaacgcc aaagagagag gggaaaagca      1860
     gactcaggaa cggacatgct ctgtgtggtc acttcttcga gcaggcaaca aggctttcaa      1920
     aaacctactg tattcatctc agtcagaagc cgtgctctac cccgtgtgcc atgtgcggaa      1980
     tctgatgctg tggagcgcag tgtaccttcc ctgcccatcc ccatctaccc ccacagatga      2040
     cagctgtgca ccatacccag tcccaggcac tagccctgat gagcccccac tgagccggct      2100
     acccaagact agatcatttg acaatctgac cacaacctgc gaaaacatgg tgccgctggc      2160
     cagccggcgc agcagtgacc ccagcctgaa tgagaagtgg caggagcacg ggcgctcgct      2220
     ggagctgagc agctttgcca gcgctgggga agaggtgcct gctatggaca gcctgcgcaa      2280
     gcccagcagg ctgctcggag gtgctgagct ttctgtggca gccggagtgg ctgaagggca      2340
     gatggagaac attttgcaag aggccaccaa agaggagagt ggggtagaag agcctaccca      2400
     cagggggcac actgaggtgc cagaggtcaa agaggaggca cccctagcaa aagaaagtag      2460
     catggcggcc gagggccccg ttgtacttta ccaagaacca cagctggatg acgctacttt      2520
     aagaagccat caaggcccca gcctctcttt gttctcccag ggtattcctg aacatcagga      2580
     tgggcacaat gtcctctcta gttcactcca agctcctctc agtggagagg actcccagga      2640
     ggtccctgta gaacagcctc aagtagagaa tattgcagag gacagggaga atgtagctcc      2700
     tgctgtccca gtagatgcaa aagttggcct tggtatctca cagtctagtt ctctgctgcc      2760
     ttcccaagtc ccattcgaga caagaggacc acacatcaac aactccgtgc acatgttact      2820
     cgaagataag gtaaagtcag aaagtgggcc ccagctccat cacagacctt gcccagcaag      2880
     cagtggtaga ttcagtggca aggacatgct tcctgtagca ccagagccca ggtctgctga      2940
     gaggccccag tgggactctg tgctacacag gacttcatcc cctggcaaca cccttagcct      3000
     gctgcaggct ccttgtgcct tgccgttaga taaatgtaga cagggaattg tgtgcaacgg      3060
     tgccctagag actgaaaaca aggcctcaga acagcctgca gggtttgaca cccttcagaa      3120
     gtaccccaca cccaatgggc attgtgccaa ttgggaggct gggaggagca aggactcact      3180
     gagccaccag ctgtctgcca caagctgtag ctctgctcac ttgtactcga ggaacttgca      3240
     ccacaagtgg ctgaatagcc actcagggag gccatccact accagcagcc ctgaccagcc      3300
     ttcccgcagc cacctggatg acgatggcat gcctgtgtac acggacacaa tccaacagcg      3360
     cctgcgacag atagagtctg gtcaccagca ggaagtggag accttgaaga aacaagtcca      3420
     ggagttgaag agtcgcctgg agagccagta cctgaccagc tctctgcgct tcaatggaga      3480
     ctttggagat gaagtggtaa gttagatgac tcgttggcta cctgaccacc tggctgccca      3540
     ctgctatgcc tgtgacagtg ccttctggct cgccagtagg aagcaccact gcaggaattg      3600
     tgggaatgta ttctgctcca gttgttgtaa ccagaaggtt ccggttccta gccagcagct      3660
     ctttgaaccc agtcgagtgt gcaagtcttg ctatagcagc ctccatccta caagctccag      3720
     cattgacctt gaactggata agcctattgc tgccacttca aactgaagct cagtgacccg      3780
     gggtggcaga ggccatgctg ctgttccttt aacaggctca cacacagcct gggcagtcca      3840
     agaggcccat acattttgga atgggggcat ggaataacct gtacagagat tgggatgtac      3900
     cactggattg taaattgatt tttgtttcat ctccccttcc cttccatcct cttctttgcc      3960
     ttctaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      4020
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa                                   4053
//


spacer
spacer