spacer

EBI Dbfetch

ID   BC031987; SV 1; linear; mRNA; STD; MUS; 2628 BP.
XX
AC   BC031987;
XX
DT   28-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus 1-acylglycerol-3-phosphate O-acyltransferase 5
DE   (lysophosphatidic acid acyltransferase, epsilon), mRNA (cDNA clone
DE   MGC:25566 IMAGE:3982362), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2628
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2628
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 682ea3bd069f3091d980e566d05a72ca.
DR   Ensembl-Gn; ENSMUSG00000031467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149565; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 30 Row: f Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542486.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2628
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:25566 IMAGE:3982362"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2628
FT                   /gene="Agpat5"
FT   CDS             7..1104
FT                   /codon_start=1
FT                   /gene="Agpat5"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 5
FT                   (lysophosphatidic acid acyltransferase, epsilon)"
FT                   /db_xref="GOA:Q9D1E8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="MGI:MGI:1196345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E8"
FT                   /protein_id="AAH31987.2"
FT                   /translation="MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPAR
FT                   LYQRVDDRLYCVYQNMVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADM
FT                   LAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG
FT                   TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHL
FT                   DAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKW
FT                   LHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTE
FT                   SGRKLYMGTWLYGTLLGCLWFVIKA"
FT   misc_difference 501
FT                   /gene="Agpat5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 591
FT                   /gene="Agpat5"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1041
FT                   /gene="Agpat5"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1218..1222
FT                   /gene="Agpat5"
FT                   /note="5 bases in cDNA are not found in the mouse genome."
FT   misc_difference 1398
FT                   /gene="Agpat5"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1455
FT                   /gene="Agpat5"
FT                   /note="'A' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1584
FT                   /gene="Agpat5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1676
FT                   /gene="Agpat5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1750^1751
FT                   /gene="Agpat5"
FT                   /note="4 bases in the mouse genome, TATT, are not found in
FT                   cDNA."
FT   misc_difference 2219
FT                   /gene="Agpat5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2482
FT                   /gene="Agpat5"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 2565..2628
FT                   /gene="Agpat5"
FT                   /note="polyA tail: 64 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2628 BP; 741 A; 500 C; 579 G; 808 T; 0 other;
     gagaggatgc tgctgtccct ggtgctccac acgtactcta tgcgctacct gctccccagc        60
     gtcctgttgc tgggctcggc gcccacctac ctgctggcct ggacgctgtg gcgggtgctc       120
     tccgcgctga tgcccgcccg cctgtaccag cgcgtggacg accggcttta ctgcgtctac       180
     cagaacatgg tgctcttctt cttcgagaac tacaccgggg tccagatatt gctatatgga       240
     gatttgccaa aaaataaaga aaatgtaata tatctagcga atcatcaaag cacagttgac       300
     tggattgttg cggacatgct ggctgccaga caggatgccc taggacatgt gcgctacgta       360
     ctgaaagaca agttaaaatg gcttccgctg tatgggttct actttgctca gcatggagga       420
     atttatgtaa aacgaagtgc caaatttaat gataaagaaa tgagaagcaa gctgcagagc       480
     tatgtgaacg caggaacacc aatgtatctt gtgattttcc cagagggaac aaggtataat       540
     gcaacataca caaaactcct ttcagccagt caggcatttg ctgctcagcg cggccttgca       600
     gtattaaaac acgtactgac accaagaata aaggccactc acgttgcttt tgattctatg       660
     aagagtcatt tagatgcaat ttatgatgtc acagtggttt atgaagggaa tgagaaaggt       720
     tcaggaaaat actcaaatcc accatccatg actgagtttc tctgcaaaca gtgcccaaaa       780
     cttcatattc actttgatcg tatagacaga aatgaagttc cagaggaaca agaacacatg       840
     aaaaagtggc ttcatgagcg ctttgagata aaagataggt tgctcataga gttctatgat       900
     tcaccagatc cagaaagaag aaacaaattt cctgggaaaa gtgttcattc cagactaagt       960
     gtgaagaaga ctttaccttc agtgttgatc ttggggagtt tgactgctgt catgctgatg      1020
     acggagtccg gaaggaaact ctacatgggc acctggttgt atggaaccct ccttggctgc      1080
     ctgtggtttg ttattaaagc ataagcaagt agcaggctgc agtcacagtc tcttattgat      1140
     ggctacacgt tgtatcacat tgtttcctga attaaataag gagttttctt gttgttgttt      1200
     ttttgttttg ttttgttttg ttctgtttta agccttgatg attgaacact ggataaagta      1260
     gagtttgtga ccacagccaa catgcatttg atttggggca aacacatgtg gcttttcagg      1320
     tgctggggtt gctggagaca tggaagctaa gtggagttta tgctgttttt ttttttttaa      1380
     tgttttcatg aattaatgtc cacttgtaaa gattattgga tactttctgt aattcagaag      1440
     gttgtatttt aacaatagtt tgcagtatgt ttcgctatat tggttatctt ccatttgact      1500
     acttggcagc tcagactctt aatactaaag tattttacat tttgaagcta tgtgatactg      1560
     gttttttgtt gttgttgttg ttaatttctg aaagtcaatg aaagacactg taatgatgcg      1620
     ttaagatgtt ccaagaaaaa ggtgagaatt attcatggca aaaaagatct gtctaatgta      1680
     tatttttatt atattgctct atttagctaa ttttctttat atttgcaaaa taatgaacat      1740
     ttttaatatt aaaatgcttg atttgcatac ccccgattct acagagaata atgtgtaaag      1800
     tgtcagaata gacttgaagc tctgctgtga ctcagtctcc tttgtcagag cttctagtag      1860
     cccagctact gagctgcttt gttagtacct ccagcacctg agccgttaag tacttataaa      1920
     tgcaagggac ccgttatctt catatcggaa tagacatgaa cagagctcta aggcgatgaa      1980
     agtctgccag catcctctct gtcctcgcac gtgccttctg cctggctcca tttgctttgg      2040
     cactgcgttc gatctagagt gtaggtgctc actgcttatt tcagccctgg ctctgtggtt      2100
     ttgtgtcctc cagtggtgct gttcactgtt ggggtgcagg tggtgctgcc ctgactcaga      2160
     ggggcagctc cctggctcct gagggtgagc cttcttggct actacagaag tattgtgcat      2220
     ttgtttatgg caagaaccat caggattgga taaatgtgtt atttctcttt gatttccatg      2280
     gagccacact gttggtacat gtcccctgtg aacagagcta cctttcagga gcacatcata      2340
     ctgtcgtgag tcacggcacg gtgtgtcctg tgagaagagg ctttctaacg tgtgatttgc      2400
     cgtgtttcta tgttgtgatt taagcgtgat tgcctactag tcattcaagg taacatttct      2460
     gcaaatttca tacagatttt ttgtcacaaa attactatac caatgatcta gttgaaatag      2520
     accaattgaa tcacaataaa taattttttt taattgaggg aaaaaaaaaa aaaaaaaaaa      2580
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                   2628
//


spacer
spacer