Dbfetch

ID   BC031918; SV 1; linear; mRNA; STD; MUS; 3136 BP.
XX
AC   BC031918;
XX
DT   10-SEP-2002 (Rel. 73, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 11)
XX
DE   Mus musculus G protein-coupled receptor 37, mRNA (cDNA clone MGC:36067
DE   IMAGE:5364562), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3136
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3136
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 13cf715dddc1555235f20e09e7a82740.
DR   Ensembl-Gn; ENSMUSG00000039904; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030503; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030476; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030403; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030486; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030199; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030940; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029601; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030177; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030321; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030275; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030408; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030311; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030970; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029315; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029677; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200812; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076528; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0076608; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0076512; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076547; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076170; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077020; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076735; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0076135; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0076282; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0076177; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0076333; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076190; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077255; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075299; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 53 Row: h Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6754055.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3136
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:36067 IMAGE:5364562"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3136
FT                   /gene="Gpr37"
FT                   /note="synonym: Pael-R"
FT   CDS             753..2555
FT                   /codon_start=1
FT                   /gene="Gpr37"
FT                   /product="G protein-coupled receptor 37"
FT                   /db_xref="GOA:Q9QY42"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1313297"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY42"
FT                   /protein_id="AAH31918.1"
FT                   /translation="MPARGAPLSRTSRLLLLLLFKVSVSAALSFVPEPRNGTCLGESCS
FT                   PLIQRRSRDARGPGNSAKDALRVHVPREKLEAEVRGATSWDLPPPRGGDTGVIEEAAAA
FT                   GPLGPPTKPPSAWRWKSAQGKEPSGHLRRRDPTDPQLFFPTSEGGEMSSKRDGIPQSRQ
FT                   EHSVKTEPRDLFYWPRRTGQLQDSQHRPSAVHEGRTLAPPGRALPQNGSADDWVPDQGG
FT                   PRRGNTTRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRS
FT                   ISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLC
FT                   ALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSG
FT                   QAPAERCVIKISPDLPDTIYVLALTYDGARLWWYFGCYFCLPTLFTITCSLVTARKIRK
FT                   AEKASTRGNKRQIHLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLL
FT                   NIISQFLLFFKSCVTPVLLFCLCRPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTT
FT                   ELELSPFSTIRREMSTFASVGTHC"
FT   misc_difference 3073..3136
FT                   /gene="Gpr37"
FT                   /note="polyA tail: 64 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3136 BP; 764 A; 797 C; 760 G; 815 T; 0 other;
     cgctccactc cacgccttct cagcccgtgc actaggcgca gccgctggcg ccatccactt        60
     gtcaactttg aactgaagga gcagcaactt tgacagtggc cgcgggtttc gaatctggct       120
     tctccttggc aacagtccct ttgaaagtcg tcggagttaa acgaagcaag agtttcctct       180
     gtgctccggt ggtgccttgt ttgcaagggt ccccaccccc cacccccccg ccagccgaga       240
     gtgggattgt gacagccagt cccctagtgg agcggacttg tttttctttt tctctagaga       300
     cctctactag cgactggata aagcagtatg gaaaggatgt aaatagcaga gcaactgtta       360
     ccaagaagac agccaccacc caaaggctgg gaggagcgcg gggcttcctc caggctgcgc       420
     ccagtcgcaa cattagggaa caatcaggtg gtgttcgcaa cttttcaagg tcagcctctt       480
     ggatctgtta tttccctggg aaccttcggg tgcaccgagc ttggattaga tttggctggg       540
     aaatgctcag aacatgaaac gtggaaggat tgtagggatg tgttgatgac accgtccttc       600
     cccaagcgcc ctgttccctc ccagcaatct tctgctccca tcctctaccc agcggtgagt       660
     atgtgacatg tgcctaactc tctgcaccaa gtttggcagc aggtgtcggt gctaagctag       720
     agccaggcta gtaggtgcgc cctcgccgag ccatgccagc ccggggcgcg cctctctcgc       780
     gcacatcgcg gctgctgctc cttctgctgt ttaaggtttc tgtctctgct gccctgagct       840
     ttgtccctga gcccaggaat ggaacttgtc tgggggagag ctgttcccca ctgatccaac       900
     gccgcagcag ggatgcccgt ggacctggga attcggcaaa agacgctctg cgagtccatg       960
     tgcccagaga gaaactggaa gcagaggtga gaggggcgac ctcttgggac ctcccaccac      1020
     ccaggggcgg tgacacaggt gtgattgaag aagcggcggc tgctgggccc ttgggacctc      1080
     caaccaagcc accaagtgcc tggagatgga aaagtgccca gggtaaagaa ccatccgggc      1140
     atttgaggag aagggacccc acggatcccc aactcttctt tccgacatcg gaggggggag      1200
     agatgagttc caagcgcgat gggattcccc agagcaggca ggagcacagt gtgaaaacgg      1260
     aacccagaga tcttttttac tggccacgaa gaactggaca actccaggat tcccaacaca      1320
     ggccttcagc agtacacgaa ggaaggaccc ttgctcctcc aggcagggca ctaccgcaaa      1380
     acgggtctgc agatgactgg gttcctgacc aagggggtcc acgccgtgga aacaccacgc      1440
     ggcgcgtgag attgaagaac cccttctacc cattgaccca agaatcctac ggagcctatg      1500
     cggtcatgtg cttatctgtg gtgatctttg ggaccggcat tattggcaac ttggcagtga      1560
     tgtgcatcgt gtgtcacaat tactacatga ggagcatctc caattctctc ttggccaacc      1620
     tggctttctg ggactttctc atcatcttct tctgcctccc cctggtcatc ttccatgagt      1680
     tgactaagaa gtggcttttg gaagatttct cctgcaagat cgtgccctat atcgaggtgg      1740
     cttctctggg tgtcactacc ttcaccttat gtgcactgtg catagatcgc ttccgggctg      1800
     ccaccaacgt ccagatgtac tatgaaatga ttgaaaattg ctcttccacc actgccaaac      1860
     ttgccgttat ctgggttgga gctctgcttt tggcccttcc ggaagttgtc ctccgccagc      1920
     tgagcaagga agatttgggc tttagtggcc aggctcctgc agaacggtgt gtcataaaga      1980
     tctctcctga tttaccggac acaatctatg ttttggctct cacctatgat ggtgcaaggc      2040
     tttggtggta ttttggctgc tacttttgtc tgcccacact tttcaccatc acctgctctc      2100
     tagtgactgc tcggaagatc cgcaaagcgg agaaggccag tacccgtgga aacaagcggc      2160
     agatccatct agagagccag atgaactgca cagtggtggc tctgaccatt ttatatgggt      2220
     tttgcatcat ccctgagaat atctgcaaca ttgtcactgc ctacatggcc acgggcgtct      2280
     ctcagcagac catggacctg ctcaacatca tcagccagtt ccttttgttt ttcaagtcct      2340
     gtgtcacccc cgtgctcctc ttctgcctct gcagaccctt cagcagggcc ttcatggagt      2400
     gctgctgctg ctgctgtgag gagtgtatcc agaagtcttc cactgtgacc agtgacgaca      2460
     acgacaacga gtacaccaca gagctggagc tgtcgccctt cagtactatc cgcagggaga      2520
     tgtccacttt tgcttctgtg gggactcatt gctgaaggaa cggcttggtt agctctgatt      2580
     tcttcgattt tcatattctg tgaaaatttt tactccatat ttttccttac aggggaacaa      2640
     tgcacacatt ttgaaaagca agtagaggaa gacatattaa ctactctaga actgattttg      2700
     caaattaata tttgtgctct gggaaaaaat gtttctattt agttatgtaa gaagaaggag      2760
     gccaacagtc tcagatcatt tttttctgct atggtgctaa tattttattc aaaagttatt      2820
     gcaccttaac aatattaatt gtttgatttc tttctttctt ttaaaaacat aatcgttgta      2880
     tattgaaggc aggcccggga ttttgctagt tattttgtgt ttgagttgtg attggaagta      2940
     cattgtattt gaaatggttt gttttttcca gccatgcaac ttagcaccaa ataaacttct      3000
     catccttctt taatatgact gtcaatctac ttttaaccaa gactcaataa attttttaat      3060
     tgccttaaat aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3120
     aaaaaaaaaa aaaaaa                                                      3136
//