Dbfetch

ID   BC031774; SV 1; linear; mRNA; STD; MUS; 2553 BP.
XX
AC   BC031774;
XX
DT   28-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha, mRNA
DE   (cDNA clone MGC:25310 IMAGE:4503697), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2553
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2553
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0e06f3b27fc4d72ab70de1377bb550a8.
DR   Ensembl-Gn; ENSMUSG00000028126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107236; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: l Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982832.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2553
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:25310 IMAGE:4503697"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2553
FT                   /gene="Pip5k1a"
FT                   /note="synonym: Pipk5a"
FT   CDS             408..2048
FT                   /codon_start=1
FT                   /gene="Pip5k1a"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase, type 1
FT                   alpha"
FT                   /db_xref="GOA:P70182"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="MGI:MGI:107929"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70182"
FT                   /protein_id="AAH31774.1"
FT                   /translation="MASASSGPAAAGFSSLDAGAPAGTAAASGIKRATVSEGPSASVMP
FT                   VKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESI
FT                   FFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGA
FT                   SGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGK
FT                   NIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFL
FT                   DADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAP
FT                   QKALYSTAMESIQGEARRGGTVETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKK
FT                   LEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPTKKFRSGPSFSRRS
FT                   GPSGNSCTSQLMASGEHRAQVTTKAEVEPDVHLGRPDVLPQTPPLEEISEGSPVPGPSF
FT                   SPVVGQPLQILNLSSTLEKLDVAESEFTH"
FT   misc_difference 2537..2553
FT                   /gene="Pip5k1a"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2553 BP; 611 A; 651 C; 669 G; 622 T; 0 other;
     ccaccctgag ccgagcggtg gagttgggga taaacaggca gtggctgggg aggtgaggga        60
     gggggggcat tcgcttttgg gggcacctca ggtgcctagg ttttccttta ggtttgttct       120
     atccgagacg cgggactccc ggggcccggc tcaagtgttc ctgtctggta agagaaggta       180
     gctttggcgg agagcagttc aagttgctag gaaggtgcga gactgcagct ctcccccatg       240
     ccgggcaagt ggtgcggtcc tgagcttgtc ctggagcctg aacaacgcct gtgagaagcc       300
     cgccgaacgc gggttctgtg aagagacgtg gggaagattc gattccgaga aaaggaaaag       360
     ccggattgaa agggagcgaa gccgctgagg gggagggggc tgccaagatg gcgtccgcct       420
     cctcagggcc agcggcggcc gggttttcat cccttgatgc cggggcccct gctggtaccg       480
     cagcagcatc tggaatcaag agagccacag tatctgaggg accttccgcc tctgtcatgc       540
     ctgttaaaaa aataggccat cgaagtgttg attcctctgg agagactaca tacaagaaga       600
     caacttcatc agccttgaaa ggtgccatcc agttaggcat cactcacact gtgggcagcc       660
     tgagcaccaa accagagcgt gatgtcctca tgcaagactt ctacgtggtg gagagcatct       720
     ttttccccag tgaaggcagc aacctgacac cggctcacca ttacaatgac tttcgattca       780
     agacctatgc gcctgttgcc ttccgttact tcagagagct ctttggcatc cggcctgatg       840
     attacttgta ctccctttgc agtgagccat tgattgaact ctccaattct ggagctagtg       900
     gttccctctt ctatgtgtcc agtgatgatg aattcatcat taagaccgtc cagcataaag       960
     aagcagaatt tctgcagaag ttgcttccag gatactacat gaatcttaac caaaaccctc      1020
     gtactttgct gcccaaattt tatggattgt actgtgtgca agcaggcggc aagaacatac      1080
     gaattgtggt gatgaacaat ctcttgcctc ggtcagtcaa aatgcatatg aaatatgacc      1140
     tgaagggttc aacttacaag cggcgggctt ctcagaaaga acgagagaaa actctcccca      1200
     cctttaaaga cctggacttc ctacaagata tccctgacgg cctatttttg gatgctgaca      1260
     tgtacagtgc tctgtgtaag actctacagc gtgactgttt ggtgctgcag agcttcaaga      1320
     taatggacta cagcctgttg atgtccatcc acaacatgga ccatgcacag agggagccca      1380
     cgagcaatga cacacagtac tcggctgaca cgcgcagacc agccccacag aaggcgctct      1440
     attccacagc tatggaatcc atccagggcg aggctcgacg gggcggcact gtggagactg      1500
     aggaccacat gggtggcatc cctgcccgga ataacaaagg agaaaggctc ctgctttata      1560
     ttggcatcat tgatattctt cagtcctaca ggtttgttaa gaagttggag cactcttgga      1620
     aagcactggt ccatgatggg gatacggtgt cagtgcatcg tccaggcttc tatgctgagc      1680
     ggttccagcg tttcatgtgc aacacagtgt tcaagaagat tcccttgaag ccttctccta      1740
     ccaaaaagtt tcggtctggc ccgtctttct ctcggcgatc aggccccagc ggcaactcct      1800
     gcacctccca gctgatggcc tctggggaac acagagcaca agtgaccacc aaggcggaag      1860
     tggagccaga tgtacacctt gggcgtcctg atgtcttacc tcagactcca cctttggagg      1920
     aaataagtga gggttcacct gttcctggcc ccagtttctc acctgtagtt ggacaacctt      1980
     tgcaaatact aaatttgagt tcaaccttgg aaaagcttga tgttgcagag tcagagttca      2040
     cccactgagc agtgagcctc agaagacctg aaacaagact ctgctgtcgc tttgatccca      2100
     agatgtcagc ccttgcccca ggaatgctga atcgtcttct tggtcatcaa cagaggagag      2160
     aatgtggagc tagcagggct ctgacactgt ctccccttcc tctgggcagt agtgcctttg      2220
     acagttgagg acagcatcgt ccccaccact ccagaagtgg gtggcgtgaa ttttccactg      2280
     cctgccatgg cttctatagc tgaatatttt tcaaaccccc attctttgtg ctgacatggg      2340
     gttgctggac tggtggtttc ctcctgttta cctttctcct ggagctggac tcttcatttc      2400
     ctcaggacgg actggctgga cattgttcct gccttggctc tcccgctggt ctttggagac      2460
     tcccaatgat ttgtataaag gtgtttgggg gaaagtaagg atcatcctta ctcccaacct      2520
     tcttttcctt aaaaaaaaaa aaaaaaaaaa aaa                                   2553
//