spacer

EBI Dbfetch

ID   BC031196; SV 1; linear; mRNA; STD; MUS; 3203 BP.
XX
AC   BC031196;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus gamma-aminobutyric acid (GABA-A) receptor, pi, mRNA (cDNA
DE   clone MGC:37685 IMAGE:5059564), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3203
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3203
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3a401c79e60d38ba43a94b3890e12cad.
DR   Ensembl-Gn; ENSMUSG00000020159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020366; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 58 Row: n Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981871.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3203
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:37685 IMAGE:5059564"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3203
FT                   /gene="Gabrp"
FT                   /note="synonym: MGC38123"
FT   CDS             173..1495
FT                   /codon_start=1
FT                   /gene="Gabrp"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor, pi"
FT                   /db_xref="GOA:Q8QZW7"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008100"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:2387597"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZW7"
FT                   /protein_id="AAH31196.1"
FT                   /translation="MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLT
FT                   AGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKS
FT                   FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMD
FT                   LSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVS
FT                   QQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTT
FT                   VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
FT                   GPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKI
FT                   SRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF"
FT   misc_difference 325
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2889
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2900
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3017
FT                   /gene="Gabrp"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3019..3026
FT                   /gene="Gabrp"
FT                   /note="8 bases in cDNA are not found in the mouse genome."
FT   misc_difference 3161
FT                   /gene="Gabrp"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3187..3203
FT                   /gene="Gabrp"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3203 BP; 847 A; 762 C; 670 G; 924 T; 0 other;
     ctgggtgcat acttaacacc caaagagtca ggactgagat gaaaaggacc ctggagaccc        60
     aaaagagtat gctctgtgtg agagtcctgc ctgagatctg gaaacacctg ctgtaacagc       120
     tgcctggtga ttcctccttc aacctttttg tgtgtgaatc agctccttca acatgagcta       180
     cagcctctat ttggccttcc tgtgtctgag tctcctcact cagaggacgt gcatccaggg       240
     gaaccaggtc aatgtggagg tcagcagaag tgacaagctt tccttacctg gctttgagaa       300
     cctcactgca ggatataaca aatttctcag gcccaatttc ggtggtgacc cagttcggat       360
     agcactgact ctggacatcg ccagcatctc tagcatctca gagagtaaca tggactacac       420
     agccactata tacctccggc agcgttggac agacccacgg ctagtgttcg aaggcaacaa       480
     gagctttact ctagatgccc gccttgtgga gttcctctgg gtgccagaca cttacattgt       540
     agagtccaag aagtccttcc tccatgaagt cacagtggga aacaggctca tccgcctctt       600
     ctccaacggc acagtcctgt acgcacttag aatcacaaca acagttacat gtaacatgga       660
     tctgtctaaa taccccatgg acacacagac ctgcaagctg cagctagaaa gttggggata       720
     cgatggcaat gatgtggagt tctcctggct gagagggaat gactcggtgc gtggacttga       780
     aaacctgcgc cttgctcagt acacaatcca acagtatttc accctggtca ccgtatccca       840
     gcaggagaca ggaaactata cgagattggt tttgcaattt gagcttcgga ggaacgtcct       900
     gtatttcatt ctggaaacct atgtcccttc caccttcctg gtggtgttat cctgggtctc       960
     cttttggatc tccctcgatt cagttcctgc gagaacctgc attggagtga caacggtgtt      1020
     atccatgaca acgctgatga tcggctcccg cacatcccta cccaacacca actgcttcat      1080
     aaaggccatc gatgtgtacc taggcatctg cttcagcttc gtgtttgggg ccttactgga      1140
     gtatgcagtt gctcactaca gctccttaca gcagatggca gtcaaagata gggggccagc      1200
     gaaggactcg gaagaagtca atatcaccaa catcatcaac agctccatct ccagctttaa      1260
     acggaagatt agctttgcca gcattgaaat ctctggtgac aatgtcaact atagtgactt      1320
     gacaatgaaa gccagcgaca agtttaagtt tgtcttccga gagaagatca gcagaatcat      1380
     tgattatttc acaattcaaa accccagcaa tgtggatcga tactccaaac tactatttcc      1440
     tttgattttt atgttggcca atgtatttta ctgggcatac tacatgtatt tttgagacgc      1500
     cattgaactc ttgcatcaca taatgaggtt aagggtattc tagaacatgt gtgtgcactt      1560
     cagcttagaa agctacaaat gggctaatgt aacaattatt ctaagttgtg tagaagccct      1620
     agtgtgacca gattctataa tagagtcatt ataaggcaac ccttttcttc ttcaattttg      1680
     gacagaacac cccctccaca cacatacaca gaacccaaga ctgcgaacct actcagggct      1740
     atttgctctc tggatccctg gtctgcattc actccataaa aatgtgggaa gatgattaca      1800
     tatattaagg ggtttatttt ctaaagaatt catagtgcca ctgattacat ctctgtggcc      1860
     cttataatat gctctcttgc ctatttaaac accagtgttt tctaattttt gtttttcctt      1920
     gaaatatgaa atgtgggttt gcgtcaattc attggtggtt accttgcctc atcaacctaa      1980
     taccagatgg gttcttagtg ttatttaata ccacagaaga attgtcccca aattctaata      2040
     catcctatta ttcacaaatc agatgtaaat gaataaaatt agtggatcaa taaactaaaa      2100
     gaaaaaaaca taaatccttt ggggtccagg gcttcatgcc gtttttccac gtatcttatt      2160
     attttgtttt tatacacctt agtcctaacc tatgtaaaaa ccccttttcc acatcaggaa      2220
     aacgggagga agttttgaaa cttgttctgg attcctaata cagaatgcgt ccatgaagac      2280
     ttgctgagtc aagtgtacta gctagccacc tttactcaca tactggctag gaaccaagta      2340
     gaccagagag tgctctgtca acctgtcctc tctgctgacc tgttgaccaa gatgctgggg      2400
     aacattttgc cggtggcaaa ggccctgcct ccttcaaaga ggagctttta tccctgtgct      2460
     ccagtgacta ggcaggagtg atgtctatta gataagaagc ggcactactg ggacacaagt      2520
     agcttatctt aaatagttac cttttcccaa cctttctagc tggactactt tgagtggatt      2580
     accctgcctg agcagcagac cactggccct gactggttcc gactgttctg aacgatggaa      2640
     agacacattg cacaacccac gtgagctgtc ttttctgagt tcagccaggg tcaccctgac      2700
     ctaggagctc ttgtgtgccc tctctctctc ttgctccacg ggaatcgcct atataaggtt      2760
     ccaatgcagc ctcaattgtt tcaaagactc ttgctgtctt caggtctttc ccttcctttt      2820
     ctaatgaacc ctcagctttc cctgtccttt ctacaacaaa ccggggctgt agatgttctt      2880
     tcctttcatg tccttcacct acgggccctc cttttcatca gcatggctct gcccatcgtt      2940
     ccgtttctgt gagcttgagt gcctggcgct taacagatgt ttctatttta ggattcgctt      3000
     tgttcattgg agtacactct taagctaggt gtagttgcgc cattagagtt cttagtagaa      3060
     tctctttgta ttttgtatct gtcatataca ttcctaaggg gaggggctag gggaggggaa      3120
     gtgtggttga gtgagtaggt catacctgtg catttttttt aaaaaataaa aatgtttaaa      3180
     atataaaaaa aaaaaaaaaa aaa                                              3203
//


spacer
spacer