spacer

EBI Dbfetch

ID   BC031184; SV 1; linear; mRNA; STD; MUS; 1677 BP.
XX
AC   BC031184;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus epidermal growth factor-containing fibulin-like extracellular
DE   matrix protein 1, mRNA (cDNA clone MGC:37612 IMAGE:4989603), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1677
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1677
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c963994406504c5ed701c371816cdf78.
DR   Ensembl-Gn; ENSMUSG00000020467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020759; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 58 Row: g Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 22122482.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1677
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:37612 IMAGE:4989603"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1677
FT                   /gene="Efemp1"
FT                   /note="synonym: MGC37612"
FT   CDS             69..1232
FT                   /codon_start=1
FT                   /gene="Efemp1"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 1"
FT                   /db_xref="GOA:Q8K0J4"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="MGI:MGI:1339998"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K0J4"
FT                   /protein_id="AAH31184.1"
FT                   /translation="MATSGVVPGGGFMASATAVAGPEVQTGRNNFVIRRNPADPQRIPS
FT                   NPSHRIQCAAGYEQSEHNVCQDIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGE
FT                   QCVDIDECTVPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCY
FT                   NILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYEVVR
FT                   SRTCQDINECETTNECREDEMCWNYHGGFRCYPRNPCQDHYVLTSENRCVCPVSNTMCR
FT                   ELPQSIVYKYMSIRSDRSVPSDIFQIQATMIYANTINTFRIKSGNENGEFYLRQTSPVS
FT                   AMLVLVKSLSGPREYIVDLEMLTVSSIGTFRTSSVLRLTIIVGPFSF"
FT   misc_difference 1652..1677
FT                   /gene="Efemp1"
FT                   /note="polyA tail: 26 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1677 BP; 528 A; 361 C; 358 G; 430 T; 0 other;
     ctcagcaaga aacaccagct gcagaagctt cgtcaggtgc caccactggg actgtagctg        60
     ccaggagcat ggcaaccagt ggtgtggtgc ctgggggtgg cttcatggcc agtgctactg       120
     cagttgctgg ccctgaagtt caaactggcc gaaataactt tgtcatccga agaaacccag       180
     ctgaccctca gcgcatccct tccaaccctt cccaccggat ccagtgtgca gcaggctatg       240
     aacagagtga gcataatgtg tgccaagata ttgatgagtg cacctcaggg actcacaatt       300
     gtagaacgga ccaagtatgc atcaatttac gaggttcctt cacatgtcag tgtcttcctg       360
     ggtatcagaa gcgaggtgaa cagtgtgtgg atatagatga atgcacagtg cctccatatt       420
     gccaccaaag atgtgttaac acacctggtt ccttctactg ccagtgcagt ccagggtttc       480
     agctggcagc aaacaactac acttgtgtgg atataaatga atgtgatgcc agcaaccagt       540
     gtgctcaaca atgctacaac attcttggct cattcatctg tcagtgtaat caaggatatg       600
     aactaagcag tgacagactc aactgtgaag acatcgacga atgcagaacc tcaagctacc       660
     tatgccaata tcaatgtgtc aatgaacctg ggaagttctc atgtatgtgc ccacagggtt       720
     acgaagtggt gcgcagcaga acctgtcagg atataaatga atgtgagacc accaatgaat       780
     gccgagaaga tgagatgtgc tggaattacc atgggggctt ccgctgttac ccacgaaacc       840
     catgtcaaga tcactatgtt ctaacatcag aaaaccgatg tgtttgccca gtctcaaaca       900
     ctatgtgccg ggagctgccc cagtccattg tctacaaata catgagcatc cgatctgaca       960
     ggtccgtgcc ttcagacatc ttccagatac aggcaacaat gatttatgca aacaccatta      1020
     atacttttcg gattaaatct ggaaatgaaa atggagagtt ctacctacga caaacaagcc      1080
     ctgtgagtgc aatgctggtg cttgtgaagt ctctatcagg accaagagaa tacatcgtgg      1140
     acctggagat gctgacagtc agtagtatag gaaccttccg cacaagctct gtgttaagat      1200
     tgacaataat agtggggcca ttttcatttt agccttttac tcatataaag cctactacaa      1260
     gcatttaaat cagccaaaca atatcattac cttaaaactc tattttattt atagctatat      1320
     ctagtacatg tatattcaaa tagctagact atggtaagaa gtgggcattt aatccataag      1380
     agtcaatgtt tatcgttatc actgtgtgta aattagacct ttatccaaca ttaagagagc      1440
     taatcatata ttatctagtg aaacttggat tctttcctgc aaaatgggac caagcaagga      1500
     tactgttctg tgttgtatag agaaatatac acctccacag accatcccgt gagaattggc      1560
     catcttagca tgaagatcaa gaaggagggt ttttttaact gctttgtaag aaaatggaaa      1620
     aaagtcaata aagatatatt tctttagaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa         1677
//


spacer
spacer