spacer

EBI Dbfetch

ID   BC031165; SV 1; linear; mRNA; STD; MUS; 2009 BP.
XX
AC   BC031165;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus oxoglutarate dehydrogenase (lipoamide), mRNA (cDNA clone
DE   IMAGE:4983309), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2009
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2009
RA   Strausberg R.;
RT   ;
RL   Submitted (03-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; e8d25f6f7075dada8f52935682c96532.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 59 Row: n Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2009
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="IMAGE:4983309"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2009
FT                   /gene="Ogdh"
FT                   /note="synonym: 2210412K19Rik"
FT   CDS             9..974
FT                   /codon_start=1
FT                   /product="Ogdh protein"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="AAH31165.1"
FT                   /translation="MNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQF
FT                   GDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDP
FT                   DVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRH
FT                   PEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEE
FT                   VAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPV
FT                   WYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
FT   misc_feature    9..944
FT                   /note="SucA; Region: 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes [Energy
FT                   production and conversion]"
XX
SQ   Sequence 2009 BP; 527 A; 556 C; 469 G; 457 T; 0 other;
     gcatccccat gaaccacctt tggccaaatc aggcccctta cactgtatgc aacagctcgc        60
     tgtctgagta cggtgtcctg ggctttgagc tgggctttgc catggctagc cctaatgctc       120
     tggttctctg ggaggcccag tttggtgact tcaacaacat ggcacagtgc atcattgacc       180
     agttcatctg cccaggacag gcaaagtggg tgcggcagaa tggcattgtg ctcctgctgc       240
     ctcatggcat ggaaggcatg ggtcccgagc attcctctgc ccgcccagag cggtttctgc       300
     agatgtgcaa tgatgaccca gatgtcctgc ctgacctgca ggaagaaaac tttgacatca       360
     atcagctcta tgactgcaac tggattgttg tcaactgttc cacccctggc aacttcttcc       420
     atgtgctgcg acgacagatc ttgctgccct tccggaagcc gttaatcgtc ttcactccca       480
     aatccctcct gcgccaccct gaggcaagaa ctagctttga cgagatgctg ccaggaacgc       540
     acttccagcg tgtgatccca gaaaatggac ctgcagctca ggacccacac aaagtcaaga       600
     gacttctctt ctgcactggg aaggtgtact atgacctcac ccgagagcgc aaagccagga       660
     acatggagga ggaggtggct attacaagga ttgagcagct atcaccattc ccctttgacc       720
     tcctgctgaa agaggcacag aagtatccca atgctgagct ggcctggtgc caggaagagc       780
     acaagaacca aggctactat gactatgtca agccaagact tcgtaccacc attgaccgtg       840
     ctaagcctgt ctggtatgct ggccgagacc cggcagctgc tccagccact ggcaacaaga       900
     aaacacacct gacagagctg cagcgctttc tggacacagc ctttgacctg gacgcattca       960
     agaaattctc ttagatgctc ctggagttga tgaggccatg gcccccatgt ccatgacgct      1020
     ctttgcttct caactaaaga atagtgcctc agcactgtcc acacgtccct tcgctgtgcc      1080
     acaccacccc tgttctcata ggaattaagt tgtccactgc agtgctcagc tgctccccgg      1140
     tcacatgctg cccagcctgt gccgacttct ctcaggctgc acaccgttca tggagaccgg      1200
     aaggagcaga ataaggaaag ggcccctctc aggacatcct agagaaggaa ggcagctctg      1260
     gccccaccca tgcccccagt gcaatcctcc agggtaggaa cagaacccta tgtggcttcc      1320
     cagggtacta gcactcagcc ctcgtcaccc atcaagtcgc agattcaagg ccaggagtag      1380
     tttcatcttg ctagggccaa gctgagagct catggaggaa ctatagctgc caggatttgg      1440
     gagtcatcag gatgttgtgt gaatagagat tgtcatgggg tatttagagg attttagcag      1500
     tgatgttagt ctagccctgc tacccttctt gggtttgggc tgtatgtggg aaacttaccc      1560
     cagctaccac gcctggagag cttggctctg agtacggccc agaagctcca ttggctccca      1620
     acgccaggca ctgctgcctc ttggtcctgc tgcctctgct ctcctgaccc ctccccagtc      1680
     acttcatttt ctctgttgtt cccttgaaca cacagaagct gttgacgaat tctttttttt      1740
     gctgtgccaa ggcaggtcaa aagcagatca gtggataaga gcaagttgtc ccaaggagcc      1800
     agctgtcctt cctccctctt ttgacctcca ctgggacaca cctgatttat ttattttggt      1860
     taaaaaaaaa aaaggaaatg aaaaaagaac aaccaccttt gcattgcatc ggcttgaccc      1920
     ataaactaag ttatcatggc caaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1980
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                                        2009
//


spacer
spacer