spacer

EBI Dbfetch

ID   BC030926; SV 1; linear; mRNA; STD; MUS; 2337 BP.
XX
AC   BC030926;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus solute carrier family 12 (potassium/chloride transporters),
DE   member 8, mRNA (cDNA clone MGC:31673 IMAGE:4910321), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2337
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2337
RA   Strausberg R.;
RT   ;
RL   Submitted (03-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; d5d0256b4ab04f47d3f1e8530cc7a0ad.
DR   Ensembl-Gn; ENSMUSG00000035506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121925; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 44 Row: k Column: 9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2337
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:31673 IMAGE:4910321"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2337
FT                   /gene="Slc12a8"
FT                   /note="synonym: CCC9"
FT   CDS             125..2002
FT                   /codon_start=1
FT                   /product="Slc12a8 protein"
FT                   /db_xref="GOA:Q8VI23"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="MGI:MGI:2443672"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VI23"
FT                   /protein_id="AAH30926.1"
FT                   /translation="MWEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTGVLLGLLL
FT                   VSFVVLVALITVLSGIGVAEHGGISSGGVYSMISSVLGGQMGGTVGLLYVFGQCVAGAM
FT                   YITGFAESISDLLGLGDIWAVRGISVAVLLALLGINLAGVKWIIRLQLLLLLLLAVSTL
FT                   DFVVGSFTHLDPEHGFIGYSPELLQSNILPEYSPGESFFTVFGVFFPAATGVMAGFNMG
FT                   GDLRDPADSVPLGSLAAVGVSWFLYIIFAFLLGAVCTREALRSDFLIAEKKGPNKTPVA
FT                   AICLTSLVTMAFVLVGQVNVLAPVVTINFMLTYIMVDYSYFALSMAHCGLAPSPEPVPR
FT                   QGPDTLHCSEHLLQDRAPSYGSDVPARSLSEGTLLEFTKDMDQFLQPIEELESRQLGSR
FT                   EGNNPKNQKRKGKKGAKQTLQDSFLLDPGSPLSFPTRTSERLSVAFCGEQESYQKQQTS
FT                   RSESHDHLVPDLRNQPRVNREDFFLKCRLQEQEIQRRPSVFYACMCNPWVSLLGALASL
FT                   LIMFVIQWLYTLASMGVAALVYFYIGQASPGLYLGSASNFSFFQWMKSFLVPSCRSLRS
FT                   AQEQIILAPSPAKVDMAMTQLTQDNADFATRDRYHHSSFLSREQLMPPY"
FT   misc_feature    332..1126
FT                   /note="PotE; Region: Amino acid transporters [Amino acid
FT                   transport and metabolism]"
XX
SQ   Sequence 2337 BP; 512 A; 639 C; 602 G; 584 T; 0 other;
     gggaagaatg ccacgagtgg aggctgagac tcaaatgata tgaactccct ttaataacaa        60
     atcagatcaa agtcagaagg gcatcctggc ccagccccag ccctggtgga agatccagct       120
     gttcatgtgg gagccggtgc tgtttgggac ctgggatggt gtgttcacat cctgcatgat       180
     caacattttt ggcgttgtcc ttttcttgag gaccggctgg ctggtgggaa acacaggtgt       240
     gctcctgggc ttgctcctgg tgtccttcgt cgtcctcgtg gccctcatca ccgtgctgtc       300
     gggcattggt gtcgcagagc atggcgggat cagcagtggc ggtgtctact ccatgatctc       360
     ctcggtgctt ggtgggcaga tgggaggcac tgtggggctg ctctatgtat ttggacagtg       420
     tgttgcaggt gctatgtaca tcaccggctt tgcggagtcc atctcagatc tgctgggact       480
     tggggacatc tgggcagtgc gtggaatttc agttgctgtg cttctggctt tgctgggcat       540
     caacctggca ggtgtcaagt ggattatccg cctccagctg ctgctgctgc tcctgctggc       600
     tgtctcgacc ctggactttg tggtgggctc tttcacccac ctggacccag aacatggctt       660
     tattggctac tccccagaac tgctacagag caacattctg ccagagtaca gccccgggga       720
     gtcattcttc actgtgtttg gggtgttctt ccctgcagct acaggagtca tggctggctt       780
     caacatggga ggagacctga gagaccctgc tgacagtgtc cccttaggct ccctagcagc       840
     tgttggcgtc tcgtggtttc tctacatcat ctttgccttc ctgcttggtg ccgtctgtac       900
     ccgagaggcc ctccgctctg acttcctgat agctgaaaag aaagggccaa ataaaacacc       960
     ggtagcagcc atctgcctga ccagcttggt gaccatggcc tttgtcctgg tgggtcaggt      1020
     gaatgttctg gcgcccgttg tcaccatcaa tttcatgctg acctacatca tggtggacta      1080
     ctcttacttc gccctctcca tggctcactg tggcctcgcc ccatctcctg agcccgtccc      1140
     cagacaaggc ccagatactc tgcactgctc tgagcacctg ctccaggaca gggctcccag      1200
     ctacggctct gatgtccctg ccagaagcct ctctgagggc accctgctgg agttcaccaa      1260
     ggacatggat cagttcctcc agccaataga ggaactggag agtcgtcagc ttgggtcaag      1320
     agaaggaaac aacccaaaga atcagaagcg caagggtaag aaaggcgcca agcaaaccct      1380
     acaagatagc ttcctcttgg accctgggtc tcctttgtcc tttcctacga ggacttctga      1440
     gaggttgtct gttgccttct gtggggagca agagtcctat cagaagcagc agacttctag      1500
     gagtgaatca catgaccatc ttgttcctga tctacgcaac cagcctagag tgaacagaga      1560
     agatttcttt ctgaaatgca gacttcagga acaagagatc cagagaagac caagtgtttt      1620
     ctatgcttgc atgtgtaacc cctgggtctc cctgttaggg gctcttgcat ccctgctcat      1680
     catgtttgtg atccagtggc tctataccct agctagtatg ggtgttgctg cccttgtgta      1740
     tttctacatt ggccaggcaa gtccaggcct ttacctcgga tcagcatcaa acttcagctt      1800
     tttccaatgg atgaagtcct tcttggtccc ctcctgcagg agcctgaggt ccgcccagga      1860
     gcaaatcatc ttggcgccat caccagccaa ggttgacatg gcaatgactc agcttaccca      1920
     ggacaatgca gacttcgcca cccgagatcg ttaccaccac tcctccttcc tgagccggga      1980
     gcagttgatg cctccctact aggacctcgc tggaccccac ctttctagaa gccgctgtgg      2040
     agatggggga cccaagcctc agaacctttg gaagttgctt ctaccaataa gaaaacccaa      2100
     gactggtctt cccaccacag ccttggacgc tggaaatcac attccggtct gaaatggcat      2160
     gtctagccag atactaggta tgactatggc ttccacgtgt gcccaacctg aagagtccac      2220
     aggcaccagg atgatcaggt gacaccaaga caaccaaatg tggagaatca aaacgagatt      2280
     tcttattcta aggggccaaa ataaacactt ctttttaatt ttaaaaaaaa aaaaaaa         2337
//


spacer
spacer