spacer

EBI Dbfetch

ID   BC030471; SV 1; linear; mRNA; STD; MUS; 2681 BP.
XX
AC   BC030471;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus reticulon 4 receptor-like 1, mRNA (cDNA clone MGC:40829
DE   IMAGE:5368560), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2681
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2681
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 62821f64256631a2f28a35835131188a.
DR   Ensembl-Gn; ENSMUSG00000045287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102514; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 65 Row: h Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 32129298.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2681
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:40829 IMAGE:5368560"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2681
FT                   /gene="Rtn4rl1"
FT                   /note="synonyms: Ngrl2, Ngrh2"
FT   misc_difference 1..12
FT                   /gene="Rtn4rl1"
FT                   /note="12 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             494..1831
FT                   /codon_start=1
FT                   /gene="Rtn4rl1"
FT                   /product="reticulon 4 receptor-like 1"
FT                   /db_xref="GOA:Q8K0S5"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:2661375"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K0S5"
FT                   /protein_id="AAH30471.1"
FT                   /translation="MLRKGCCVELLLLLLAGELPLGGGCPRDCVCYPAPMTVSCQAHNF
FT                   AAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEE
FT                   LDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEY
FT                   LQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVHHKAFHDLHR
FT                   LTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVP
FT                   CATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRAARKEHHPSHGASRDKG
FT                   HPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDYAPDYQHKFSFDIMPT
FT                   ARPKRKGKCARRTPIRAPSGVQQASSGTALGAPLLAWILGLAVTLR"
FT   misc_difference 2651..2681
FT                   /gene="Rtn4rl1"
FT                   /note="polyA tail: 31 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2681 BP; 577 A; 829 C; 732 G; 543 T; 0 other;
     ccacgcgtcc gggaagggag gcgccccgct cggcggatcg ctcggtcctg caaacgcgcg        60
     ccgggcgctt tcccggagct aggctgtgcg tacgagcgcc cttttgcagc agccgctgcc       120
     cgagggggcg gggaagaggg gacatcggct ggccggctag ggggcggcgt cccccctcaa       180
     aaccgcctgc aaagtgtttg gggcggcaga atcaggccgc cggctcggcg gagcaagcca       240
     ctcgcccggg gctgagcgag cgcaccgcgt tggttggcag cgccgcggtt gctagcaggc       300
     gccggtgccc tgagcaccgg gtttgggctc accatgcccc tgcgggaccg ggccgccggg       360
     cacaagcgga ttcccggctt gcccccgcct cgacgcgctc ggattagctg cagctggcgc       420
     ccagggattt gaatctggac cccaggaggg agcgcgccta ggccgacctc ggagcggcgg       480
     ccccgcggcc aacatgcttc gcaaagggtg ctgtgtggaa ttgctgctgt tgctgctcgc       540
     tggagagcta cctctgggtg gtggttgtcc tcgagactgt gtgtgctacc ctgcgcccat       600
     gactgtcagc tgccaggcac acaactttgc tgccatcccg gagggcatcc cagaggacag       660
     tgagcgcatc ttcctgcaga acaatcgcat caccttcctc cagcagggcc acttcagccc       720
     cgccatggtc accctctgga tctactccaa caacatcact ttcattgctc ccaacacctt       780
     cgagggcttt gtgcatctgg aggagctaga ccttggagac aaccgacagc tgcgaacgct       840
     ggcacccgag accttccaag gcctggtgaa gcttcacgcc ctctacctct ataagtgtgg       900
     actgagcgcc ctgcccgcag gcatctttgg tggcctgcac agcctgcagt atctctactt       960
     gcaggacaac catatcgagt acctccaaga tgacatcttt gtggacctgg tcaatctcag      1020
     tcacttgttt ctccatggta acaagctatg gagcctgggc caaggcatct tccggggcct      1080
     ggtgaacctg gaccggttgc tgctgcatga gaaccagcta cagtgggttc accacaaggc      1140
     tttccatgac ctccacaggc taaccaccct ctttctcttc aacaacagcc tcactgagct      1200
     gcagggtgac tgtctggccc ccctggtggc cttggagttc cttcgcctca atgggaatgc      1260
     ttgggactgt ggctgccggg cacgttccct gtgggaatgg ctgcgaaggt tccgtggctc      1320
     tagctctgct gtcccctgcg cgacccccga gctgcggcaa ggccaggatc tgaagctgct      1380
     gagggtggag gacttccgga actgcacagg accagtgtct cctcaccaga tcaagtctca      1440
     cacgcttacc acctctgaca gggctgcccg caaggagcac catccgtccc atggggcctc      1500
     cagggacaaa ggccacccac atggccatcc gcctggctcc aggtcaggtt acaagaaggc      1560
     aggcaagaac tgcaccagcc acaggaaccg gaaccagatc tctaaggtga gctctgggaa      1620
     agagcttacc gaactgcagg actatgcccc cgactatcag cacaagttca gctttgacat      1680
     catgcccacc gcacgaccca agaggaaggg caagtgtgct cgcaggaccc ccatccgtgc      1740
     ccccagtggg gtgcagcagg catcctcagg cacggccctt ggggccccac tcctggcctg      1800
     gatactgggg ctggcagtca ctctccgctg aggacccagg gctccgtcac ccagcactgc      1860
     cacatgtcca gcaaggaaca gaattttttt cttcttttct ttctttcttt cttttttttt      1920
     tcctaagtgg aagatctgct gggtttcagg aaaaggctgc tgaagccttc agccaccgtc      1980
     tggacccttc ctggtggatt ataagcccaa aatgtacagc cgtagacggg aagggtatca      2040
     cgtctcactc ggctgtcctg accgagcgcc tctggaccgt atccactcca gcacagtggt      2100
     caaaggcacg caaagtgagt cattagtggt gtcgggacat gcgccccttg aagaagctgg      2160
     gctctgcgga agcctggtca tttggagaga agggctgaag gaccctgctg gttttggaag      2220
     gagcaggact cagaacaagg ctctcccaga gccagctggg gcaaccagca atctcagagc      2280
     actcttggct cttgtctgag atcacttagt taacctgccc tgtccaaccc tatgccaccc      2340
     tcagtcccta tccatggggg taatgcctct cattcctgac gtctcaggca gcccccggca      2400
     gacctgctgg ggtccaagaa ccaatcacca aaggagagat cgccagtgga tgacatttag      2460
     aactgtactc gcaatgagag tcacacagaa ggtgcagttt tatacctatg tccacttata      2520
     tatatcctca ctctgcccac acacccacat aatatatata tatatataaa tatataaatg      2580
     cacaggtccc ccaacccact ccttaccaaa ctgtatgtct tatcatgttt ataaactata      2640
     cgggaaccta aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a                          2681
//


spacer
spacer