spacer

EBI Dbfetch

ID   BC030350; SV 1; linear; mRNA; STD; MUS; 1152 BP.
XX
AC   BC030350;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus gamma-aminobutyric acid receptor associated protein, mRNA
DE   (cDNA clone MGC:40719 IMAGE:5102114), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1152
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1152
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 90229a560467e9a2c7b9a41ece74562e.
DR   Ensembl-Gn; ENSMUSG00000018567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018711; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 65 Row: c Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254379.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:40719 IMAGE:5102114"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1152
FT                   /gene="Gabarap"
FT   misc_difference 1..9
FT                   /gene="Gabarap"
FT                   /note="9 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 11
FT                   /gene="Gabarap"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             353..706
FT                   /codon_start=1
FT                   /gene="Gabarap"
FT                   /product="gamma-aminobutyric acid receptor associated
FT                   protein"
FT                   /db_xref="GOA:Q9DCD6"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="MGI:MGI:1861742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCD6"
FT                   /protein_id="AAH30350.1"
FT                   /translation="MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
FT                   KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFF
FT                   LYIAYSDESVYGL"
FT   misc_difference 391
FT                   /gene="Gabarap"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1129..1152
FT                   /gene="Gabarap"
FT                   /note="polyA tail: 24 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1152 BP; 280 A; 301 C; 285 G; 286 T; 0 other;
     ccacgcgtcc gactttgtac tgtgggaaag ggtttttcag ttcactcgaa acaacagcaa        60
     ccttatctgc gatgtcatat gtgtaaccca caagttgatt ccaaagcagt tacgctgaag       120
     gcgtaagagg accaggctac gggttgcgct agcaagctga gctagtggcg tatgttagca       180
     ggcggggccg gtccgatggt cgggggcggg gttgatgaat agggaagtgg cgcaaattcg       240
     tggatcgctc cgccaagtct gttcgtcgaa gccgcctccg ccgccgcccc ctgtcccggc       300
     cccccccctg ggttccctca gcccagctcg gtccagcccg gttctcggga gaatgaagtt       360
     cgtgtacaaa gaggagcatc cgttcgagaa acgccgctct gagggcgaga aaatccgaaa       420
     gaaataccca gaccgggtcc cggtgatagt ggaaaaagcc cccaaagctc ggataggaga       480
     cctggacaaa aagaaatacc tggtgccttc tgatcttaca gttggtcaat tctacttctt       540
     gatccggaag cgaattcatc tccgtgctga agatgccttg tttttctttg tcaacaatgt       600
     cattccaccc accagtgcca cgatgggtca gctgtaccag gaacaccatg aagaagactt       660
     ctttctatac attgcctaca gtgatgaaag cgtctatggt ctgtgaagct gctgtacctg       720
     aggtgggggg ttccattcta cgaagagagg tggcgctcct tccttgacat ccagttcctc       780
     cttcaggctc aaacaccacc tcctttcttc aggacctgca cttaatgttt gaggctgtct       840
     ctccagtccc tctcagcagg aggggtaatg gtagatacag cctccataca tctctttctc       900
     cccttgttta ccctccattc ccactctgat ttagacttct tgattgtcga tctctgtcac       960
     atccgatgat tgttttggtt tctattccct ttctaactgc ccatcgggct cagaacccca      1020
     ataatccctt cctttcacta tcttcttttt ggggggtagg tggaagggat tgacattgga      1080
     tgggggaggt aggaggcaca tcaataaaaa ggaaaccacc gagctgaaaa aaaaaaaaaa      1140
     aaaaaaaaaa aa                                                          1152
//


spacer
spacer