spacer

EBI Dbfetch

ID   BC030326; SV 1; linear; mRNA; STD; MUS; 2009 BP.
XX
AC   BC030326;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone IMAGE:5375595), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2009
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2009
RA   Strausberg R.;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; f1e9ddb9d4e37ae9c768c88d44ebef2c.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 65 Row: m Column: 11
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2009
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="IMAGE:5375595"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2009
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   CDS             361..1662
FT                   /codon_start=1
FT                   /product="Atp1a1 protein"
FT                   /db_xref="GOA:Q8K2R2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K2R2"
FT                   /protein_id="AAH30326.1"
FT                   /translation="MIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_feature    361..1626
FT                   /note="MgtA; Region: Cation transport ATPase [Inorganic ion
FT                   transport and metabolism]"
XX
SQ   Sequence 2009 BP; 470 A; 511 C; 535 G; 493 T; 0 other;
     ccacgcgtcc gcctcccaca gctgcgtggg aggactgttc ccaaggtcag ctgtctgatg        60
     gggcctagtg gctccagagt gtggctgggc ttcatttact tctgtccttg catttcagtc       120
     gcacattaag ataaaccctg cctttttagc agatagggtt taagtgccgt ggagcactgg       180
     acaaacaatg gatccttttt cttgtccctc agtatcttag atggatattt ccttggagaa       240
     cgtgtgctag gtttctgcca cctcctcctg cctgacgaac agtttcccga aggcttccag       300
     tttgacactg acgatgtcaa tttccccgtg gataacctct gcttcgtggg tcttatctcc       360
     atgattgacc ctccccgagc tgctgtcccc gatgctgtgg gcaaatgccg cagcgctggg       420
     attaaggtca tcatggttac aggagaccat ccaatcacag cgaaagccat tgccaagggg       480
     gtaggcatta tctcagaagg caatgagact gtggaagaca ttgctgcccg cctcaacatt       540
     ccagtgaacc aggtgaaccc cagagatgcc aaggcctgtg tggtccacgg cagtgacctg       600
     aaggacatga cctccgagga gctggatgac atcttgcggt accacacaga gatcgtcttt       660
     gccaggacct ctcctcagca gaagctcatc attgtggagg gctgccagcg gcagggcgcc       720
     atcgtggccg tcacagggga tggtgtcaat gactctccag ctttgaaaaa ggcagatatt       780
     ggggttgcca tggggattgt tggctctgat gtgtccaagc aagctgctga catgatcctt       840
     ctggatgaca actttgcctc cattgtgact ggagtagagg aaggtcgtct gatttttgat       900
     aacttgaaga aatccatcgc ttacacccta accagtaaca ttccggaaat cacccccttc       960
     ttgatattta ttattgcaaa cattccactg cccctgggga ctgtgaccat cctctgcatt      1020
     gacttgggca ctgacatggt tcctgccatc tccctggcct acgagcaagc tgagagcgac      1080
     atcatgaaga ggcagcccag aaaccccaaa acggacaaac ttgtgaacga gcgtctgatc      1140
     agcatggcct atggacagat cggtatgatc caggccctgg gaggcttctt cacttacttt      1200
     gtgattctgg ctgagaacgg tttcctgccc tttcacctgt tgggcatccg agagacctgg      1260
     gatgaccgct gggtcaacga tgtggaggac agctacgggc agcagtggac ctacgagcag      1320
     aggaagatcg tggagttcac ctgccataca gcgttctttg tcagtattgt ggtagtgcag      1380
     tgggccgact tggtcatctg caagaccaga aggaattctg tcttccagca gggaatgaag      1440
     aacaagatct tgatatttgg cctctttgaa gagacagccc ttgctgcttt cttatcctac      1500
     tgccccggga tgggggcagc ccttaggatg tatcccctca aacctacatg gtggttctgt      1560
     gccttcccct actcccttct catctttgtg tatgacgagg tgcggaagct cattatcagg      1620
     cggcgccctg gcggctgggt ggagaaggaa acctactact agcccactgc cctgcacgcc      1680
     gtggaacatt gtgccacaca ctgcacccac ccctaccccc tctttgtgta cttcaagtct      1740
     tggagctcgg aactctaccc tggtaggaaa gcaccaaagc atgtggggat gcagacgtcc      1800
     tggaatgaag catgtagctg taacgggggg cggggcgggg gggagggctg cctgagaaac      1860
     accgtgtacg gggacgacag cgggcaaggt ttatacgtgc ctttttgttt ttgtaaaaaa      1920
     ggaaaacctg gaaagactga aagattacgt tttatatctg gatttttaca aataaagatg      1980
     gctattataa cggaaaaaaa aaaaaaaaa                                        2009
//


spacer
spacer