spacer

EBI Dbfetch

ID   BC030321; SV 1; linear; mRNA; STD; MUS; 2437 BP.
XX
AC   BC030321;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus regulator of G-protein signaling 14, mRNA (cDNA clone
DE   MGC:40927 IMAGE:5374531), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2437
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2437
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7d31966d6a8ee9f8e6872af5f12215f1.
DR   Ensembl-Gn; ENSMUSG00000052087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063771; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 65 Row: m Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2437
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:40927 IMAGE:5374531"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2437
FT                   /gene="Rgs14"
FT   misc_difference 1..11
FT                   /gene="Rgs14"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             133..1776
FT                   /codon_start=1
FT                   /gene="Rgs14"
FT                   /product="regulator of G-protein signaling 14"
FT                   /db_xref="GOA:P97492"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="InterPro:IPR003116"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1859709"
FT                   /db_xref="PDB:1WFY"
FT                   /protein_id="AAH30321.1"
FT                   /translation="MPGKPKHLGVPNGRMVLAVSDGELTSTAGSQAQGEGRGSSLSIHS
FT                   LPSGPSSPFSTEEQPVASWAQSFERLLQDPRGLAYFTEFLKKEFSAENVTFWKACERFQ
FT                   QIPASDTKQLAQEAHNIYHEFLSSQALSPVNIDRQAWLSEEVLAQPRPDMFRAQQLQIF
FT                   NLMKFDSYARFVKSPLYQECLLAEAEGRPLREPGSSHLGSPDTARKKPKLKPGKSLPLG
FT                   VEELGQLPLAEGPCGRPLRKSFRREMTGGAMNSALRRESQGSLNSSASLDLGFLAFVSS
FT                   KSESHRKSLGSGESESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSL
FT                   PDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFQLELVGLERVVRISAKPTKRLQ
FT                   EALQPILAKHGLSLDQVVLHRPGEKQPMDLENPVSSVASQTLVLDTPPDAKMSEARSIS
FT                   PCRSQGCLPRTQTKDSHLPPSSSSLLVEDASSSTGNRQTCDIEGLVELLNRVQSSGAHD
FT                   QRGLLRKEDLVLPEFLQLPSQRPGSREAPP"
FT   misc_difference 2329..2437
FT                   /gene="Rgs14"
FT                   /note="polyA tail: 109 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2437 BP; 614 A; 669 C; 678 G; 476 T; 0 other;
     ccacgcgtcc ggtaagggcc cggaggagca gagctctctc tctccactgc ctgcttgcca        60
     ccccaagaga gtgcttccgc gatccttgtg gtgggtggcc ccccgtggag gggacctgtg       120
     atcaacggcg gtatgccagg gaagcccaag cacttgggtg tccccaacgg gcgcatggtt       180
     ctggctgtct cagatggaga actgaccagc actgcaggtt cccaggccca gggtgagggc       240
     agaggcagct ctctcagcat ccacagcctc cctagtggcc ccagcagccc cttctccacc       300
     gaggagcagc ctgtggccag ctgggcccag tcctttgagc ggctgctgca agacccacgg       360
     ggtctggctt acttcactga gttcctgaag aaggaattca gcgcagagaa cgtaactttc       420
     tggaaagcct gcgaacgttt ccagcagatc ccagccagcg acaccaagca gctagctcag       480
     gaggcccaca acatctacca cgagttccta tccagccagg cgctgagccc agtgaacatc       540
     gaccgacagg cctggcttag tgaggaggtg ctggcccagc cccggccaga tatgttccga       600
     gcacagcagc ttcagatctt caatttgatg aagttcgaca gctatgcgcg cttcgtcaaa       660
     tccccgctgt accaagagtg cctgctggcg gaggccgagg gacgccccct gcgggaacct       720
     ggctcctcac acctcgggag cccggacaca gcgaggaaga agccaaagct gaagcctggg       780
     aagtcactgc cgctgggcgt ggaagagttg gggcagctgc cactcgctga gggcccttgt       840
     ggccgccctc tccgcaagtc ctttcgtaga gagatgacag gtggagccat gaattcggcc       900
     ctgcgacgag agtctcaagg gtccctgaat tcttctgcca gtctggacct gggtttcctt       960
     gcctttgtga gcagcaaatc tgagagtcac cggaagagcc ttggaagtgg agagagtgag      1020
     agcgagagtc ggccggggaa gtattgctgc gtgtatctac ctgacggcac ggcttccttg      1080
     gccctggctc gacctggcct caccatccga gacatgctgg caggcatctg tgagaagaga      1140
     ggcctctctc tgcctgacat taaggtctac ctggtgggca atgaacagaa ggccctggtc      1200
     ctggatcagg attgcaccgt gctggcagac caggaagtgc gactggaaaa caggatcacc      1260
     ttccagctgg agttggtcgg cctggagcga gtggtccgga tctcagctaa gcccaccaag      1320
     cgtctgcaag aggcgctgca gcccatcctg gctaagcatg gcctgagcct ggaccaggtg      1380
     gtactgcaca ggccaggaga gaagcagccc atggatttgg agaatccagt gagctcagtg      1440
     gcctcacaga cactggtttt ggacactcct ccggatgcaa agatgagtga agccagaagc      1500
     atatccccct gccgcagtca gggatgcctc ccaagaaccc agaccaagga cagtcacctt      1560
     cccccatcgt cctccagttt gctggtagaa gatgccagta gttctactgg gaaccggcag      1620
     acctgtgaca ttgaaggcct ggtggagctg ctgaatcggg tgcagagcag cggggcccac      1680
     gatcagagag gacttcttcg caaagaggac ctggtccttc cagaatttct gcagcttcct      1740
     tcccaaagac caggctctcg ggaggctcca ccatagactg aatcaactat tcagcccagg      1800
     gagggccctt cagactccac cacccacccg gtcctctggc atctgtgtaa caatccaggc      1860
     tatctgcatg gtgcctgggc aaaccaagca tgccacgggt ctgtgctgca tgccctatct      1920
     gtaccatgag tgtctttggc tcctttctgc tatgggcagg cccccagaaa gggccaggag      1980
     ggggtggcta actgttctct cataggtttg cctacccatt cctcccagta ggccatcaag      2040
     aggaggtggg cctagttcct tggcataagc atagtgaaca caaacgggtg actttggcag      2100
     tgccagcctc ctcaacttgt tctaggcttt agcagggggc aggaaggagg ggctggcccc      2160
     tccttaaaga gttgatataa gtaagacctg ggtgtactgg tgagcaaccc ctccctccat      2220
     ccacagactc tactgtacat atggatttta tggttggctt ggggcagctg ggtttgtcct      2280
     ggatatatgg tactgttata taataataat aattatcatt attattcaaa aaaaaaaaaa      2340
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2400
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                               2437
//


spacer
spacer