Dbfetch

ID   BC030267; SV 1; linear; mRNA; STD; HUM; 3732 BP.
XX
AC   BC030267;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens ATPase type 13A2, mRNA (cDNA clone MGC:40082 IMAGE:5240813),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3732
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3732
RA   Director MGC Project;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 84a7b1e1f633b166b33b7bbcca0dabea.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
DR   Ensembl-Tr; ENST00000341676; homo_sapiens.
DR   Ensembl-Tr; ENST00000452699; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Life Technologies, Inc.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 62 Row: l Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
CC   Differences found between this sequence and the human genome (build
CC   35) are described in misc_difference features below and these
CC   differences were also compared to chimpanzee genomic seqeunces
CC   available as of Sep 03, 03.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3732
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_121"
FT                   /clone="MGC:40082 IMAGE:5240813"
FT                   /tissue_type="Brain, fetal, whole pooled"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..3732
FT                   /gene="ATP13A2"
FT                   /note="synonym: HSA9947"
FT   CDS             178..3654
FT                   /codon_start=1
FT                   /gene="ATP13A2"
FT                   /product="ATP13A2 protein"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="H-InvDB:HIT000041006.16"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="AAH30267.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLF
FT                   QGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKS
FT                   YPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLR
FT                   DMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPREGGLMPCDAALVAGECMVNESSL
FT                   TGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAK
FT                   GGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALD
FT                   LVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDG
FT                   LDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVEST
FT                   GWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVV
FT                   VAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVP
FT                   SLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAV
FT                   TVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKVLVQGTVFARMAP
FT                   EQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIEC
FT                   VPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTV
FT                   AVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLN
FT                   RTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNERARPVPPRLPAPP
FT                   PAQAGLQEALQAAGTRAGRAALAAAARRPPEVVQAHGHPRHWNSLPLSHQLDPSPATPP
FT                   PPPPTSLRLATVYTPPPRPPPPWGSVDYCPLPWTIPRRGGSPQLPSVLLSV"
FT   misc_difference 1127
FT                   /gene="ATP13A2"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'R' in cDNA, 'Q' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1527
FT                   /gene="ATP13A2"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 2317
FT                   /gene="ATP13A2"
FT                   /note="'T' in cDNA is 'C' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
FT   misc_difference 2835
FT                   /gene="ATP13A2"
FT                   /note="'A' in cDNA is 'G' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
FT   misc_difference 3682..3732
FT                   /gene="ATP13A2"
FT                   /note="polyA tail: 51 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 3732 BP; 702 A; 1244 C; 1119 G; 667 T; 0 other;
     cgccgagcct ggtggcccag gtgccccgcc cgcgtcagcc ctgctccagc cccgcgctag        60
     cccagcgccc ctcgccccgg gccgtccgga ccgcgccccc gcccagggcc ttgcgcacgc       120
     cggggcccag gccgagggcc gcagcgccgg ggccggcgat gagcgcgagg agccggcatg       180
     agcgcagaca gcagccctct cgtgggcagc acgcccaccg gttatgggac cctgacgata       240
     gggacatcaa tagatcccct cagctcctca gtttcatccg tgaggctcag cggctactgt       300
     ggcagtccat ggagggtcat cggctatcac gtcgtggtct ggatgatggc tgggatccct       360
     ttgctgctct tccgttggaa gcccctgtgg ggggtgcggc tgcggctccg gccctgcaac       420
     ctggcccacg ccgaaacact cgttatcgaa ataagagaca aagaggatag ttcctggcag       480
     ctcttcactg tccaggtgca gactgaggcc atcggcgagg gcagcctgga gccgtcccca       540
     cagtcccagg cagaggatgg ccggagccag gcggcagttg gggcggtacc agagggtgcc       600
     tggaaggata cggcccagct ccacaagagc gaggaggcga agcgggtgct gcggtattac       660
     ctcttccagg gccagcgcta tatctggatc gagacccagc aagccttcta ccaggtcagc       720
     ctcctggacc atggccgctc ttgtgacgac gtccaccgct cccgccatgg cctcagcctc       780
     caggaccaaa tggtgaggaa ggccatttac ggccccaacg tgatcagcat accggtcaag       840
     tcctaccccc agctgctggt ggacgaggca ctgaacccct actatgggtt ccaggccttc       900
     agcatcgcgc tgtggctggc tgaccactac tactggtacg ccctgtgcat cttcctcatt       960
     tcctccatct ccatctgcct gtcgctgtac aagaccagaa agcaaagcca gactctaagg      1020
     gacatggtca agttgtccat gcgggtgtgc gtgtgccggc cagggggaga ggaagagtgg      1080
     gtggactcca gtgagctagt gcccggagac tgcctggtgc tgccccggga gggtgggctg      1140
     atgccctgtg atgccgccct ggtggccggc gagtgcatgg tgaatgagag ctctctgaca      1200
     ggagagagca ttccagtgct gaagacggca ctgccggagg ggctggggcc ctactgtgca      1260
     gagacacacc ggcggcacac actcttctgc gggaccctca tcttgcaggc ccgggcctat      1320
     gtgggaccgc acgtcctggc agtggtgacc cgcacagggt tctgcacggc aaaagggggc      1380
     ctggtgagct ccatcttgca cccccggccc atcaacttca agttctataa acacagcatg      1440
     aagtttgtgg ctgccctctc tgtcctggct ctcctcggca ccatctacag catcttcatc      1500
     ctctaccgaa accgggtgcc tctgaacgag attgtaatcc gggctctcga cctggtgacc      1560
     gtggtggtgc cacctgccct gcctgctgcc atgactgtgt gcacgctcta cgcccagagc      1620
     cgactgcgga gacagggcat tttctgcatc cacccactgc gcatcaacct ggggggcaag      1680
     ctgcagctgg tgtgtttcga caagacgggc accctcactg aggacggctt agacgtgatg      1740
     ggggtggtgc ccctgaaggg gcaggcattc ctgcccctgg tcccagagcc tcgccgcctg      1800
     cctgtggggc ccctgctccg agcactggcc acctgccatg ccctcagccg gctccaggac      1860
     acccccgtgg gcgaccccat ggacttgaag atggtggagt ctactggctg ggtcctggag      1920
     gaagagccgg ctgcagactc agcatttggg acccaggtct tggcagtgat gagaccccca      1980
     ctttgggagc cccagctgca ggcaatggag gagcccccgg tgccagtcag cgtcctccac      2040
     cgcttcccct tctcttcggc tctgcagcgc atgagtgtgg tggtggcgtg gccaggggcc      2100
     actcagcccg aggcctacgt caaaggctcc ccggagctgg tggcagggct ctgcaacccc      2160
     gagacagtgc ccaccgactt cgcccagatg ctgcagagct atacagctgc tggctaccgt      2220
     gtcgtggccc tggccagcaa gccactgccc actgtgccca gcctggaggc agcccagcaa      2280
     ctgacgaggg acactgtgga aggagacctg agcctcttgg ggctgctggt catgaggaac      2340
     ctactgaagc cgcagacaac gccagttatc caggctctgc gaaggacccg catccgcgcc      2400
     gtcatggtga caggggacaa cctgcagaca gcggtgactg tggcccgggg ctgtggcatg      2460
     gtggcccccc aggagcatct gatcatcgtc cacgccaccc accctgagcg gggtcagcct      2520
     gcctctctcg agttcctgcc gatggagtcc cccacagccg tgaatggcgt taaggtcctg      2580
     gtccagggca ctgtctttgc ccgcatggcc cctgagcaga agacagagct ggtgtgcgag      2640
     ctacagaagc ttcagtactg cgtgggcatg tgcggagacg gcgccaatga ctgtggggcc      2700
     ctgaaggcgg ctgatgtcgg catctcgctg tcccaggcag aagcctcagt ggtctcaccc      2760
     ttcacctcga gcatggccag tattgagtgc gtgcccatgg tcatcaggga ggggcgctgt      2820
     tcccttgaca cttcattcag cgtcttcaag tacatggctc tgtacagcct gacccagttc      2880
     atctccgtcc tgatcctcta cacgatcaac accaacctgg gtgacctgca gttcctggcc      2940
     atcgacctgg tcatcaccac cacagtggca gtgctcatga gccgcacggg gccagcgctg      3000
     gtcctgggac gggtgcggcc accgggggcg ctgctcagcg tgcccgtgct cagcagcctg      3060
     ctgctgcaga tggtcctggt gaccggcgtg cagctagggg gctacttcct gaccctggcc      3120
     cagccatggt tcgtgcctct gaacaggaca gtggccgcac cagacaacct gcccaactac      3180
     gagaacaccg tggtcttctc tctgtccagc ttccagtacc tcatcctggc tgcagccgtg      3240
     tccaaggggg cgcccttccg ccggccgctc tacaccaatg agcgtgctag accagtgcct      3300
     ccccgcctgc ctgcgccgcc tccggcccaa gcgggcctcc aagaagcgct tcaagcagct      3360
     ggaacgagag ctggccgagc agccctggcc gccgctgccc gccggccccc tgaggtagtg      3420
     caggcccacg ggcaccccag acactggaac tccctgcctc tgagccacca actggacccc      3480
     tctccagcaa caccaccgcc accacctccc acatccctga ggttggcgac tgtctacact      3540
     cctcccccga gaccaccccc accctgggga agcgttgact actgtcccct accttggacc      3600
     atcccgcgta ggggtggcag cccccagctc ccctcagtgc tgctgtcagt gtagcaaata      3660
     aagtcatgat attttcctgg caaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3720
     aaaaaaaaaa aa                                                          3732
//