Dbfetch

ID   BC030199; SV 1; linear; mRNA; STD; HUM; 1573 BP.
XX
AC   BC030199;
XX
DT   02-SEP-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens chromosome 18 open reading frame 1, mRNA (cDNA clone MGC:34709
DE   IMAGE:5199354), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1573
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1573
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c93756369a0ff91b705034e1ef901870.
DR   Ensembl-Gn; ENSG00000168675; homo_sapiens.
DR   Ensembl-Tr; ENST00000359446; homo_sapiens.
DR   Ensembl-Tr; ENST00000399848; homo_sapiens.
DR   Ensembl-Tr; ENST00000585931; homo_sapiens.
DR   Ensembl-Tr; ENST00000586765; homo_sapiens.
DR   Ensembl-Tr; ENST00000587757; homo_sapiens.
DR   Ensembl-Tr; ENST00000592991; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Life Technologies, Inc.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 49 Row: a Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 51093715.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1573
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_114"
FT                   /clone="MGC:34709 IMAGE:5199354"
FT                   /tissue_type="Brain, adult, 6 pooled whole brains"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1573
FT                   /gene="C18orf1"
FT   misc_feature    1..1573
FT                   /gene="C18orf1"
FT                   /note="This cDNA sequence aligns to the human reference
FT                   genome (build 36) without differences"
FT   CDS             660..1526
FT                   /codon_start=1
FT                   /gene="C18orf1"
FT                   /product="chromosome 18 open reading frame 1"
FT                   /db_xref="GOA:O15165"
FT                   /db_xref="H-InvDB:HIT000092073.15"
FT                   /db_xref="HGNC:HGNC:1224"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15165"
FT                   /protein_id="AAH30199.1"
FT                   /translation="MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEE
FT                   NCLLVTEHPPPGIFNSELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSR
FT                   RREDGLPQIMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPP
FT                   PYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGISAS
FT                   TCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQNNAESTIVPIKGKD
FT                   RKPGNLV"
XX
SQ   Sequence 1573 BP; 339 A; 500 C; 465 G; 269 T; 0 other;
     ccgagccccg gaggaagcag gcgtgtgttg aatttctctc tgcccctcac cttggaataa        60
     acaggaagcg acaagcaccc agcccggccc ggcacttgcc tttgtgaagg ggtctgccct       120
     gcacagcctt taggaagctt cctcgggacc ccttcccggt gcgccgcccc gggtgggcct       180
     gggggcgcgc cctcggttca agctctacgt tcgtgacatc aaacctcctg ttgggccatt       240
     tccgagaact cccatcagtt tctgtatagt gtaaaagttt cagaggcgga gcacagagag       300
     ctgcggctgg gacaaggagc acccgcgtgc aggtgcgacc ctgcaggatg ctggcagcgg       360
     cgtggccagg ggcgcccgtg ttctgagggc ctgagggcca gcccctccac ccgcgccatg       420
     gcctccgcgc cctggctgga cggctgacgg gagcagggac cgccgccgcc caggtgccac       480
     acccaggtac cgcccgcccg cgcgagagcc gggcaggtgg gccgcggatg ctcccagagg       540
     ccggcccagc agagcgatgg acttggacag gctaagatgg aagtgacctg agcctcgccc       600
     ggcggcttcc tcgacgggac agcgcaagag ttggagcaca ggcttgtccg gggagcagta       660
     tgccggaagc tggttttcag gccacaaatg ctttcacaga gtgcaaattc acctgcacca       720
     gtggtaaatg cttgtatctt ggttcgctgg tctgtaacca acagaacgac tgtggggaca       780
     acagtgacga agagaactgt ctcctggtga ccgagcaccc gcctccgggc atcttcaact       840
     cggagctgga gttcgcccaa atcatcatca tcgtcgtggt ggtcacggtg atggtggtgg       900
     tcatcgtctg cctgctgaac cactacaaag tctccacgcg gtccttcatc aaccgcccga       960
     accagagccg gaggcgggag gacgggctgc cgcagatcat gcatgccccg cggtccaggg      1020
     acaggttcac agcgccgtcc ttcatccaga gggatcgctt cagccgcttc cagcccacct      1080
     acccctatgt gcagcacgag attgatcttc ctcccaccat ctccctgtcc gacggtgaag      1140
     agccacctcc ttaccagggg ccctgcaccc tgcagctccg ggaccctgaa cagcagatgg      1200
     aactcaaccg agagtccgtg agggccccac ccaaccgaac catatttgac agtgatttaa      1260
     tagacattgc tatgtatagc gggggtccat gcccacccag cagcaactcg ggcatcagtg      1320
     caagcacctg cagcagtaac gggaggatgg aggggccacc ccccacatac agcgaggtga      1380
     tgggccacca cccaggcgcc tctttcctcc atcaccagcg cagcaacgca cacaggggca      1440
     gcagactgca gtttcagcag aacaatgcag agagcacaat agtacccatc aaaggcaaag      1500
     ataggaagcc tgggaacctg gtctgattcc ttccaacgtg cacttcagct ggagaaagaa      1560
     accaagaagg gaa                                                         1573
//