Dbfetch

ID   BC030031; SV 1; linear; mRNA; STD; MUS; 1508 BP.
XX
AC   BC030031;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus SLAM family member 6, mRNA (cDNA clone MGC:41003
DE   IMAGE:1225313), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1508
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1508
RA   Director MGC Project;
RT   ;
RL   Submitted (06-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; ce5dae27a4a14c44e44e48a79a7eac4f.
DR   Ensembl-Gn; ENSMUSG00000015314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000195656; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Marcello Bento Soares, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 66 Row: d Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 13507653.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1508
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Soares_thymus_2NbMT"
FT                   /clone="MGC:41003 IMAGE:1225313"
FT                   /tissue_type="Thymus gland, mouse"
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..1508
FT                   /gene="Slamf6"
FT                   /note="synonyms: SF2000, KAL1, NTBA, KAL1b, NTB-A"
FT   CDS             153..1208
FT                   /codon_start=1
FT                   /gene="Slamf6"
FT                   /product="Slamf6 protein"
FT                   /db_xref="GOA:Q9ET39"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1353620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ET39"
FT                   /protein_id="AAH30031.1"
FT                   /translation="MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGV
FT                   LGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQ
FT                   SYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQ
FT                   IHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVS
FT                   VSTQSLCKGVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPESS
FT                   QSTDGPGSPGNTVYAQVTRPMQEMKIPKPIKNDSMTIYSIVNHSREETVALTGYNQPIT
FT                   LKVNTLINYNS"
XX
SQ   Sequence 1508 BP; 482 A; 342 C; 321 G; 363 T; 0 other;
     cacgttccct actgctaaga gtcttagctt acaaaagata ttcttgtaag ccaagtgtga        60
     agttaatcac gacaaccaaa ggtttgctaa catagaggaa gagctctcat caatagggga       120
     acagaaagtc tcagcgacaa gcttatgaaa gaatggctgt ctcaagggct ccagcacccg       180
     actccgcctg tcagaggatg gtctggctct ttccacttgt cttctgcctc ggctcaggga       240
     gtgaagtttc acagagcagc tcagaccccc agctaatgaa tggcgttcta ggagagtctg       300
     cagttcttcc tctaaagctt cctgcaggga agatagccaa tatcatcatc tggaattatg       360
     aatgggaagc gtcacaagtc actgccctcg ttatcaacct aagtaatcct gaaagtccac       420
     aaatcatgaa cactgatgta aagaagagac tgaacatcac ccagtcctac tccctgcaaa       480
     tcagcaacct taccatggca gacacaggat catacactgc gcagataacc acaaaggact       540
     ctgaagtgat caccttcaaa tatattctga gggtctttga acgactgggt aacttagaaa       600
     ctaccaacta tactctcctg ctagagaatg ggacctgcca gatacacctg gcctgtgttt       660
     tgaagaatca aagtcaaact gtctcagttg agtggcaagc cacaggaaac atctctttag       720
     gaggaccaaa tgtcactatc ttttgggacc cgaggaattc tggtgaccag acttacgtct       780
     gcagagccaa gaatgctgtc agcaatttgt cagtctctgt ttcgacccag agtctctgca       840
     aaggggttct aactaatcca ccctggaatg cagtatggtt tatgactaca atttcaataa       900
     tcagtgctgt catactcatc tttgtgtgct ggagcataca tgtttggaag agaagaggtt       960
     ctcttccttt gactagccaa catccagagt cctcccagag cacagatggc ccaggctctc      1020
     cagggaacac tgtgtatgca caagtcactc gtccaatgca ggaaatgaaa atcccaaaac      1080
     ctatcaaaaa tgactccatg acaatttact ccatagttaa tcattccaga gaggaaacag      1140
     tggctttaac cggctataac caacccatta ccctgaaggt taacacttta atcaactata      1200
     actcctgaag gaagagcact gcagtgactt gaggaaatta aacaatgctg tcaccacagc      1260
     tctggcttag attaatgaag tcagcatctc tggagattga gcgctgccat ttgcattgtt      1320
     caaacgcttt ctaggtggta tggtgagatg ccagagggct aagggccatt atagcagggt      1380
     agtttgacta ggaatacata agatagaaag cctagaatca tatcattgaa agggacaatg      1440
     gacctaagag aagtggaata aaattgtgtc acgctgaaaa aaaaaaaaaa aaaaaaaaaa      1500
     aaaaaaaa                                                               1508
//