spacer

EBI Dbfetch

ID   BC029143; SV 1; linear; mRNA; STD; MUS; 1988 BP.
XX
AC   BC029143;
XX
DT   25-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus oxoglutarate dehydrogenase (lipoamide), mRNA (cDNA clone
DE   IMAGE:4946032), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1988
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1988
RA   Strausberg R.;
RT   ;
RL   Submitted (01-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 4a8cbc135dc1db62532c14c62d3e327d.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 60 Row: b Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1988
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="IMAGE:4946032"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1005
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /product="Ogdh protein"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="AAH29143.1"
FT                   /translation="LHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAM
FT                   ASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSA
FT                   RPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRK
FT                   PLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYD
FT                   LTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVK
FT                   PRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
XX
SQ   Sequence 1988 BP; 487 A; 564 C; 474 G; 463 T; 0 other;
     ctccatgatc agaatgttga caaaagaacc tgcatcccca tgaaccacct ttggccaaat        60
     caggcccctt acactgtatg caacagctcg ctgtctgagt acggtgtcct gggctttgag       120
     ctgggctttg ccatggctag ccctaatgct ctggttctct gggaggccca gtttggtgac       180
     ttcaacaaca tggcacagtg catcattgac cagttcatct gcccaggaca ggcaaagtgg       240
     gtgcggcaga atggcattgt gctcctgctg cctcatggca tggaaggcat gggtcccgag       300
     cattcctctg cccgcccaga gcggtttctg cagatgtgca atgatgaccc agatgtcctg       360
     cctgacctgc aggaagaaaa ctttgacatc aatcagctct atgactgcaa ctggattgtt       420
     gtcaactgtt ccacccctgg caacttcttc catgtgctgc gacgacagat cttgctgccc       480
     ttccggaagc cgttaatcgt cttcactccc aaatccctcc tgcgccaccc tgaggcaaga       540
     actagctttg acgagatgct gccaggaacg cacttccagc gtgtgatccc agaaaatgga       600
     cctgcagctc aggacccaca caaagtcaag agacttctct tctgcactgg gaaggtgtac       660
     tatgacctca cccgagagcg caaagccagg aacatggagg aggaggtggc tattacaagg       720
     attgagcagc tatcaccatt cccctttgac ctcctgctga aagaggcaca gaagtatccc       780
     aatgctgagc tggcctggtg ccaggaagag cacaagaacc aaggctacta tgactatgtc       840
     aagccaagac ttcgtaccac cattgaccgt gctaagcctg tctggtatgc tggccgagac       900
     ccggcagctg ctccagccac tggcaacaag aaaacacacc tgacagagct gcagcgcttt       960
     ctggacacag cctttgacct ggacgcattc aagaaattct cttagatgct cctggagttg      1020
     atgaggccat ggcccccatg tccatgacgc tctttgcttc tcaactaaag aatagtgcct      1080
     cagcactgtc cacacgtccc ttcgctgtgc cacaccaccc ctgttctcat aggaattaag      1140
     ttgtccactg cagtgctcag ctgctccccg gtcacatgct gcccagcctg tgccgacttc      1200
     tctcaggctg cacaccgttc atggagaccg gaaggagcag aataaggaaa gggcccctct      1260
     caggacatcc tagagaagga aggcagctct ggccccaccc atgcccccag tgcaatcctc      1320
     cagggtagga acagaaccct atgtggcttc ccagggtact agcactcagc cctcgtcacc      1380
     catcaagtcg cagattcaag gccaggagta gtttcatctt gctagggcca agctgagagc      1440
     tcatggagga actatagctg ccaggatttg ggagtcatca ggatgttgtg tgaatagaga      1500
     ttgtcatggg gtatttagag gactttagca gtgatgttag tctagccctg ctacccttct      1560
     tgggtttggg ctgtatgtgg gaaacttacc ccagctacca cgcctggaga gcttggctct      1620
     gagtacggcc cagaagctcc attggctccc aacgccaggc actgctgcct cttggtcctg      1680
     ctgcctctgc tctcctgacc cctccccagt cacttcattt tctctgttgt tcccttgaac      1740
     acacagaagc tgttgacgaa ttcttttttt tgctgtgcca aggcaggtca aaagcagatc      1800
     agtggataag agcaagttgt cccaaggagc cagctgtcct tcctccctct tttgacctcc      1860
     actgggacac acctgattta tttattttgg ttaaaaaaaa aaaaggaaat gaaaaaagaa      1920
     caaccacctt tgcattgcat cggcttgacc cataaactaa gttatcatgg ccaaaaaaaa      1980
     aaaaaaaa                                                               1988
//


spacer
spacer